Aptenodytes forsteri (emperor penguin): 103901743 Help Entry 103901743         CDS       T08527                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04020   Calcium signaling pathway afor04070   Phosphatidylinositol signaling system afor04114   Oocyte meiosis afor04218   Cellular senescence afor04261   Adrenergic signaling in cardiomyocytes afor04270   Vascular smooth muscle contraction afor04371   Apelin signaling pathway afor04625   C-type lectin receptor signaling pathway afor04744   Phototransduction afor04910   Insulin signaling pathway afor04912   GnRH signaling pathway afor04916   Melanogenesis Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     103901743    04020 Calcium signaling pathway     103901743    04070 Phosphatidylinositol signaling system     103901743  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103901743    04218 Cellular senescence     103901743  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103901743   09152 Endocrine system    04910 Insulin signaling pathway     103901743    04912 GnRH signaling pathway     103901743    04916 Melanogenesis     103901743   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103901743    04270 Vascular smooth muscle contraction     103901743   09157 Sensory system    04744 Phototransduction     103901743  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:afor01009]     103901743   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afor04131]     103901743    03036 Chromosome and associated proteins [BR:afor03036]     103901743   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afor04147]     103901743 Protein phosphatases and associated proteins [BR:afor01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103901743 Membrane trafficking [BR:afor04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103901743 Chromosome and associated proteins [BR:afor03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103901743 Exosome [BR:afor04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103901743 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen Dockerin_1 UPF0154 Caleosin DUF5580_M FCaBP_EF-hand SurA_N_2 SurA_N_3 SPEF2_C Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  103901743 NCBI-ProteinID:  XP_009280949 UniProt:  A0A087R8K3 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAERLGEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgggggaggagcagatcgccgaattcaaggaggctttttcccttttc gaccgggatggagatggttgcatcaccacgaaggagttgggcactgtcatgcgctcgctg gggcaaaaccccaccgaagcggagctgcaggacatggtgggggaggtggacgccgacggc agcggcaccatcgatttccccgagttcctctctctgatggcaaggaagatgagggacacg gacagcgaggaggagatccgcgaggctttccgcgtctttgataaggatggcaacggctac atcagcgcggcagagctgcggcacgtcatgaccaacctgggtgagaagctgacggatgag gaggtggacgagatgatcaaggaggccgactgcaacaatgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system