Aptenodytes forsteri (emperor penguin): 103903303 Help Entry 103903303         CDS       T08527                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04081   Hormone signaling afor04144   Endocytosis afor04150   mTOR signaling pathway afor04270   Vascular smooth muscle contraction afor04310   Wnt signaling pathway afor04350   TGF-beta signaling pathway afor04510   Focal adhesion afor04520   Adherens junction afor04530   Tight junction afor04621   NOD-like receptor signaling pathway afor04625   C-type lectin receptor signaling pathway afor04810   Regulation of actin cytoskeleton afor05100   Bacterial invasion of epithelial cells afor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103903303 (RHOA)    04350 TGF-beta signaling pathway     103903303 (RHOA)    04150 mTOR signaling pathway     103903303 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103903303 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103903303 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103903303 (RHOA)    04520 Adherens junction     103903303 (RHOA)    04530 Tight junction     103903303 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103903303 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103903303 (RHOA)    04625 C-type lectin receptor signaling pathway     103903303 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103903303 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103903303 (RHOA)    05100 Bacterial invasion of epithelial cells     103903303 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afor04131]     103903303 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afor04147]     103903303 (RHOA)    04031 GTP-binding proteins [BR:afor04031]     103903303 (RHOA) Membrane trafficking [BR:afor04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103903303 (RHOA) Exosome [BR:afor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103903303 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103903303 (RHOA)   Exosomal proteins of colorectal cancer cells    103903303 (RHOA)   Exosomal proteins of bladder cancer cells    103903303 (RHOA) GTP-binding proteins [BR:afor04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103903303 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103903303 NCBI-ProteinID:  XP_009282766 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaaatggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system