Aptenodytes forsteri (emperor penguin): 103906715 Help Entry 103906715         CDS       T08527                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04010   MAPK signaling pathway afor04068   FoxO signaling pathway afor04081   Hormone signaling afor04114   Oocyte meiosis afor04140   Autophagy - animal afor04150   mTOR signaling pathway afor04810   Regulation of actin cytoskeleton afor04910   Insulin signaling pathway afor04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103906715 (INS)    04068 FoxO signaling pathway     103906715 (INS)    04150 mTOR signaling pathway     103906715 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     103906715 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103906715 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     103906715 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103906715 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103906715 (INS)    04914 Progesterone-mediated oocyte maturation     103906715 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afor04052]     103906715 (INS) Cytokines and neuropeptides [BR:afor04052]  Neuropeptides   Unclassified    103906715 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  103906715 NCBI-ProteinID:  XP_009287016 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MLCLLTLGLSVLTMALWIQSLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERG FFYSPKARRDVEQPLVSGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgctttgcctcttaaccctaggcctcagcgtgctcaccatggctctctggatccaatcg ctgcctctcctggcccttctcgctctttctggccctgggaccagccacgcagctgccaac cagcacctctgcggctcccacttggtggaggctctctacctggtgtgtggagagcggggt ttcttctactcccccaaagcccgacgggacgttgagcagcctctagtgagcggtcccttg catggtgaggtaggggagctgcccttccaacaggaggagtttgagaaagtgaagcgaggg atcgttgagcaatgctgccacaacacatgctccctctaccaactggaaaactactgcaac taa

DBGET integrated database retrieval system