Acidithiobacillus ferriphilus: K1Y48_05130 Help Entry K1Y48_05130       CDS       T07843                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism afp  Acidithiobacillus ferriphilus Pathway afp00190   Oxidative phosphorylation afp01100   Metabolic pathways Module afp_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:afp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     K1Y48_05130 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:afp00194]     K1Y48_05130 (atpE) Photosynthesis proteins [BR:afp00194]  Photosystem and electron transport system   F-type ATPase [OT]    K1Y48_05130 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF6325 Motif Other DBs NCBI-ProteinID:  UEP60019 LinkDB All DBs Position 1031614..1031871 Genome browser AA seq 85 aa AA seqDB search MDAHTIIVAATAIAVGIIFGAAGLGSAIGWGLITSKTIEGITRQPEMRPQLLVNTFIFAG LMESFPFIILAFGFWFLFANPFLVG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggacgcacataccatcattgttgctgctactgccattgccgtaggtatcatttttggt gccgctggtctgggttccgccattggctggggtctgatcacctcaaagaccattgaaggc atcacccgccagccggaaatgcgcccgcagttgctggtgaataccttcatctttgccggt ttgatggagtctttccccttcattattctggccttcggcttctggttcctcttcgccaac ccgttcctggtgggctga

DBGET integrated database retrieval system