Alcaligenes faecalis JQ135: AFA_13115 Help Entry AFA_13115         CDS       T05446                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afq  Alcaligenes faecalis JQ135 Pathway afq00998   Biosynthesis of various antibiotics afq01100   Metabolic pathways afq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFA_13115    00074 Mycolic acid biosynthesis     AFA_13115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFA_13115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF1896 HLH EutQ Motif Other DBs NCBI-ProteinID:  ASR90312 UniProt:  A0A0A2MZV6 LinkDB All DBs Position complement(2836175..2836414) Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVDYINSHSKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgttaacgaa gccgagatcaaaaacgaatcttcttttctcgacgacctcggtgccgactcgctcgacatg gtcgagctcgtgatggcgctcgaagacgaattcgaaaccgaaataccagacgaagaagct gagaaaatcacgacggtccagcaagctgtggactacatcaattctcacagcaagcagtaa

DBGET integrated database retrieval system