KEGG   Alcaligenes faecalis JQ135: AFA_18125
Entry
AFA_18125         CDS       T05446                                 
Name
(GenBank) phosphonate ABC transporter
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:afq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AFA_18125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afq02000]
    AFA_18125
Enzymes [BR:afq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     AFA_18125
Transporters [BR:afq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    AFA_18125
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 AAA_29 RsgA_GTPase nSTAND1 AAA_25 SMC_N AAA_13 Zeta_toxin nSTAND3 ORC-CDC6-like AAA_28
Other DBs
NCBI-ProteinID: ASR91581
UniProt: A0AB33D1Z5
LinkDB
Position
complement(3970025..3970873)
AA seq 282 aa
MLRFESVGMRYPDGTTALKSVSLSVPRGQFCVLLGASGAGKSTLLRMANGLTVPTQGAVW
VDGQRVQRSSLKAVRPGIGMVHQHFNLVSRATVATNVLSGALPGLPAWRAFLMQFPASLR
ERACRLVREVGLQPEHLHRRVSELSGGQQQRVGIARAFMLEPAVLLADEPVASLDPRISR
DILSLLRSQARDRAATVLCSLHQVELAREFADRIVAVRQGVVVFDGPASAFDEAAATALY
QAGTPGSPVEAWSGAVMTPGRATASPGGSTVRPGTVLVEGVS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgttgcgttttgaatctgtggggatgcgatatcccgatggcacgactgcgctcaaatcg
gtgtctttgagtgtgcctcgaggacagttctgtgtgctgctgggggcctctggagcaggc
aaatcgaccttgttacgtatggctaatgggctcactgttcctacgcagggggcagtttgg
gtcgatggccagcgtgtgcagcgcagcagcttgaaagcggtgcgaccgggaattgggatg
gtgcatcagcactttaatttggtctcgcgtgccaccgtcgcgacgaacgtgctgtcagga
gccttgcccggtttgcctgcgtggcgagcgtttttgatgcagtttccagcctcactacgc
gagcgggcttgccgcttggtgcgtgaggtcggactacagccggagcatttgcatcggcgc
gtcagtgaactgtcgggcgggcagcagcagcgggttggtatcgcccgtgcattcatgctg
gagcctgcggtgctgctggctgatgaaccggtggccagcttggacccgcgcatcagccgt
gacattttgagtttgttgcgtagccaggcgcgtgatcgggcggcgactgttctgtgcagt
ttgcatcaggtagagctggcccgtgagtttgcggatcggattgtggcggtgcgtcagggt
gttgtggtttttgatgggccagccagtgcattcgatgaggccgcagccacagccttgtac
caggccgggacgccaggaagtcccgtggaggcatggtctggggcggtcatgacgcctggc
cgtgccactgcatcgccaggcggttcgacggtcaggccgggcactgtgttggtggagggc
gtgtcatga

DBGET integrated database retrieval system