Acidithiobacillus ferrooxidans ATCC 23270: AFE_0898
Help
Entry
AFE_0898 CDS
T00810
Symbol
hisC-2
Name
(GenBank) histidinol-phosphate aminotransferase
KO
K00817
histidinol-phosphate aminotransferase [EC:
2.6.1.9
]
Organism
afr
Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00340
Histidine metabolism
afr00350
Tyrosine metabolism
afr00360
Phenylalanine metabolism
afr00400
Phenylalanine, tyrosine and tryptophan biosynthesis
afr00401
Novobiocin biosynthesis
afr01100
Metabolic pathways
afr01110
Biosynthesis of secondary metabolites
afr01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
afr00001
]
09100 Metabolism
09105 Amino acid metabolism
00340 Histidine metabolism
AFE_0898 (hisC-2)
00350 Tyrosine metabolism
AFE_0898 (hisC-2)
00360 Phenylalanine metabolism
AFE_0898 (hisC-2)
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
AFE_0898 (hisC-2)
09110 Biosynthesis of other secondary metabolites
00401 Novobiocin biosynthesis
AFE_0898 (hisC-2)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
afr01007
]
AFE_0898 (hisC-2)
Enzymes [BR:
afr01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.9 histidinol-phosphate transaminase
AFE_0898 (hisC-2)
Amino acid related enzymes [BR:
afr01007
]
Aminotransferase (transaminase)
Class II
AFE_0898 (hisC-2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Aminotran_5
Cys_Met_Meta_PP
DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID:
ACK78629
UniProt:
B7J6V4
LinkDB
All DBs
Position
814767..815864
Genome browser
AA seq
365 aa
AA seq
DB search
MCNSYLEYTAAGVSDLRPYQPGKPLAELERELGIRDAIKLASNENPLGPSPLALAAVREV
LPALAQYPEGSAPELRALLARQLDLDPGQFIFGNGSDQVVELAVRALAGPGTEVIVSQYA
FAAYAIAAQASGATVRVAPARDYGHDLDAMASLLNANTRLVFIANPNNPTGTYLTADALE
TFIDSVPSHALVVLDEAYLELMDAADYPDGRRWLRRFGNLMLTRTFSKAYGLAGLRCGYG
IGHPDLMAVLERVRQPFNVNTLAQVAAHAALTDRAHLQATLANNRQGIVALRDGLCNLGL
TILPPAGNFTAFAVPGGGQRVYEALLLRGVIVRPLTPYGMPDHLRVSVGLPVENQRFLTM
LGEVL
NT seq
1098 nt
NT seq
+upstream
nt +downstream
nt
atgtgcaatagctatctggaatatacggcggcgggtgtgtccgatctgcgtccctatcag
ccgggcaaacccttggcggaactggaacgggaactgggtatccgtgacgccatcaagctg
gcctccaatgaaaatccgttaggtccgagccctctggcgctggcagccgtccgcgaggtg
ttgcccgccctggcgcagtaccccgaagggtcggctccggagttgcgcgcgctgctggcc
cgtcagctcgatctggaccctgggcaatttattttcggcaacggttctgatcaggtggtg
gagcttgcggtgcgtgcccttgccgggccgggtacggaggtgattgtctcgcagtatgcc
tttgccgcctatgccattgccgcgcaggccagtggtgcgactgtacgggtcgccccggcg
cgggattacggtcatgacctggatgccatggccagtctgctcaacgccaatacccggctg
gtttttatcgccaatcccaataatcccacgggtacgtatcttacggcggacgccctggag
acctttatcgacagcgtgccttcccatgcgctggtggtgctggacgaagcctacctggaa
ctgatggacgcggcggattatccggatggcagacggtggctgcggcgtttcggtaacctg
atgcttacccgtacgttttccaaggcctatgggctggcgggtctgcgttgcggttacggc
atcggccaccccgacctgatggcggtgctggagcgggttcgtcagcccttcaacgtcaat
acgctggcgcaggtggcggcgcatgccgcgcttacggatcgcgcccatctgcaggccacc
ctggccaacaaccgtcaggggatcgtggccctccgcgatggattgtgcaatcttggattg
acaattctgccgcctgcaggcaactttaccgccttcgccgtgccgggaggtggacagcgc
gtctatgaggccctgctgcttcggggggtgatcgtccggccgcttaccccttacggcatg
ccggatcatctgcgggtcagtgttggcctgccggtggaaaaccaacgttttcttacaatg
ctgggcgaggtcctgtaa
DBGET
integrated database retrieval system