Artemia franciscana: 136029839 Help Entry 136029839         CDS       T10524                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism afra  Artemia franciscana Pathway afra04137   Mitophagy - animal afra04140   Autophagy - animal afra04144   Endocytosis afra04145   Phagosome afra04148   Efferocytosis Brite KEGG Orthology (KO) [BR:afra00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     136029839    04145 Phagosome     136029839    04140 Autophagy - animal     136029839    04137 Mitophagy - animal     136029839    04148 Efferocytosis     136029839  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afra04131]     136029839   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afra04147]     136029839    04031 GTP-binding proteins [BR:afra04031]     136029839 Membrane trafficking [BR:afra04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     136029839 Exosome [BR:afra04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136029839   Exosomal proteins of other body fluids (saliva and urine)    136029839   Exosomal proteins of colorectal cancer cells    136029839   Exosomal proteins of bladder cancer cells    136029839 GTP-binding proteins [BR:afra04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     136029839 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA Motif Other DBs NCBI-GeneID:  136029839 NCBI-ProteinID:  XP_065564368 LinkDB All DBs Position 8:complement(46671677..46676429) Genome browser AA seq 157 aa AA seqDB search MVIILGDSRIGKTSFMNQYVLRKFSNEYKATIGTGIIPKEVMVDDKLVTLQIWDTAGKKR FRSLGVAFYRAAVCCVIVFDVTFASSFKFLDSWRGGFLIQISPRCPDNFPFLALGNKADV ENRAVYANRAQQWCHISLDKCFSREGASTMSNLETTK NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggtgattatattgggtgactccagaattggtaaaacatcttttatgaaccagtacgtc ctcagaaaattctcaaatgaatacaaggcaacaattggtacaggtattattccaaaagag gtaatggtggatgataagctggtaacccttcagatatgggacacggctggaaagaagaga tttcggtcccttggtgttgcgttttacagagcagctgtttgttgcgttatagtatttgat gttacatttgccagcagtttcaaatttctagactcgtggagaggcgggtttctcattcaa atttctcccagatgtcctgacaatttcccatttctggctcttgggaacaaggctgatgta gaaaatcgagccgtttacgcgaatagagctcagcaatggtgtcatatatctttagataaa tgtttcagtcgcgagggcgcatcaacgatgtcaaatttagagacgactaaatga

DBGET integrated database retrieval system