Allofrancisella frigidaquae: E3E15_05780 Help Entry E3E15_05780       CDS       T06608                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afri  Allofrancisella frigidaquae Pathway afri01100   Metabolic pathways afri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E3E15_05780 (acpP)    00074 Mycolic acid biosynthesis     E3E15_05780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E3E15_05780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIV94882 UniProt:  A0A6M3HX87 LinkDB All DBs Position complement(1243503..1243745) Genome browser AA seq 80 aa AA seqDB search MSANELYAKVNSIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDE DAEKIRTVKDVYDYIDSKVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaaacgaattatatgctaaagtaaactctatcatagttgaacaattaggcgtt aaagaagaagaccttaagccagaagcttcttttattgatgatttaggtgccgactccctt gatacagttgagttagtaatggctctagaagaagaatttgacactgaaattcctgacgaa gatgctgaaaaaatcagaactgttaaagatgtttacgactatattgactctaaagtaaac taa

DBGET integrated database retrieval system