Actinoplanes friuliensis: AFR_04585
Help
Entry
AFR_04585 CDS
T02892
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
afs
Actinoplanes friuliensis
Pathway
afs03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
afs00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AFR_04585 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
afs03011
]
AFR_04585 (rplR)
Ribosome [BR:
afs03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AFR_04585 (rplR)
Bacteria
AFR_04585 (rplR)
Archaea
AFR_04585 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DNA_photolyase
Motif
Other DBs
NCBI-ProteinID:
AGZ39206
UniProt:
U5VU97
LinkDB
All DBs
Position
1003248..1003643
Genome browser
AA seq
131 aa
AA seq
DB search
MTATLLKRRNGGGASYKRAVGKARRHFRVRKNVSGTAERPRLVVTRSTRNITAQIVDDLK
GHTLVSASTLDASLRGGEGDKSALAGKVGALLAERAKAAGVSKVVFDRGGNRYAGRIAAL
ADAAREAGLEF
NT seq
396 nt
NT seq
+upstream
nt +downstream
nt
gtgaccgccacgctgctcaagcgccgcaatggcggcggtgcgtcgtacaagcgcgccgtc
ggcaaggcacgtcggcacttccgggtccgcaagaacgtcagcggcaccgccgagcgtccc
cgtctggtcgtcacccggtccacgcggaacatcaccgcgcagatcgtcgacgacctcaag
ggccacacgctcgtgtcggcctccacgctcgacgcctccctgcggggcggcgagggtgac
aagagcgctctggccggcaaggtcggggctcttctcgccgagcgggccaaggccgcgggc
gtttccaaggtcgtcttcgaccgcggtggcaaccggtacgcggggcggatcgccgcgctg
gccgacgccgcccgcgaagccggactcgagttctag
DBGET
integrated database retrieval system