Actinoplanes friuliensis: AFR_06325
Help
Entry
AFR_06325 CDS
T02892
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
afs
Actinoplanes friuliensis
Brite
KEGG Orthology (KO) [BR:
afs00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
AFR_06325 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
AGZ39554
UniProt:
U5VRV0
LinkDB
All DBs
Position
1389252..1389542
Genome browser
AA seq
96 aa
AA seq
DB search
MALPQVAPAETPQIEEVPADDRPWVTIVWDDPVNLMSYVTWVFQKLFGYSHDKAEQLMMD
VHNKGKAIVSTGARERMEMDASQLHGYGLWATVDRG
NT seq
291 nt
NT seq
+upstream
nt +downstream
nt
atggcgttgcctcaggtcgctcccgcagagacgccgcagatcgaggaggtaccggctgat
gatcggccgtgggtgaccatcgtctgggacgatccggtcaatctcatgtcgtacgtgacc
tgggtttttcagaagttgttcggctacagccacgacaaggccgagcagctgatgatggac
gtgcacaacaagggcaaggcgatcgtgtcgaccggcgcgcgcgagcgtatggaaatggac
gcctcgcaactccacggctacggtctgtgggcgacggtggaccgggggtga
DBGET
integrated database retrieval system