Actinoplanes friuliensis: AFR_08690 Help Entry AFR_08690         CDS       T02892                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afs  Actinoplanes friuliensis Pathway afs01100   Metabolic pathways afs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFR_08690 (acpP)    00074 Mycolic acid biosynthesis     AFR_08690 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFR_08690 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGZ40027 UniProt:  U5VT84 LinkDB All DBs Position complement(1886466..1886708) Genome browser AA seq 80 aa AA seqDB search MATRAEITSGLAEILEEVAGVNPDDVAEEKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPD NEVQNLKTVGDAVSFIEANH NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcaacccgcgctgagatcacttccggcctcgccgagatcctcgaggaggtcgccggg gtgaacccggacgacgtcgccgaggagaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtggtggccgccgaggagaagttcggcgtcaagatccccgac aacgaggtccagaacctcaagaccgtcggcgacgccgtgtccttcatcgaggcgaatcac tga

DBGET integrated database retrieval system