Actinoplanes friuliensis: AFR_35625 Help Entry AFR_35625         CDS       T02892                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism afs  Actinoplanes friuliensis Pathway afs00362   Benzoate degradation afs00621   Dioxin degradation afs00622   Xylene degradation afs01100   Metabolic pathways afs01120   Microbial metabolism in diverse environments afs01220   Degradation of aromatic compounds Module afs_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:afs00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AFR_35625    00622 Xylene degradation     AFR_35625    00621 Dioxin degradation     AFR_35625 Enzymes [BR:afs01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      AFR_35625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AGZ45381 UniProt:  U5WBP7 LinkDB All DBs Position complement(7774051..7774272) Genome browser AA seq 73 aa AA seqDB search MKENAMPFANLKVPAGLLTPEQKETLVHKVTDLYAETFGDDVRDNTMVLVDEVVDGGWGI RGEVLTLAKLSGN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaggagaacgccatgccattcgccaacctcaaggttcccgccggtctgctcacgccc gagcagaaggagaccctcgtgcacaaagtcaccgacctgtacgcggagaccttcggcgac gacgtccgcgacaacaccatggtcctggtcgacgaggtggtcgacggcggctgggggatc cgcggcgaggtgctgactctcgcgaagctcagcggaaactga

DBGET integrated database retrieval system