Anoxybacter fermentans: BBF96_05070 Help Entry BBF96_05070       CDS       T05768                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism aft  Anoxybacter fermentans Pathway aft00020   Citrate cycle (TCA cycle) aft00720   Other carbon fixation pathways aft01100   Metabolic pathways aft01110   Biosynthesis of secondary metabolites aft01120   Microbial metabolism in diverse environments aft01200   Carbon metabolism aft01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:aft00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BBF96_05070   09102 Energy metabolism    00720 Other carbon fixation pathways     BBF96_05070 Enzymes [BR:aft01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BBF96_05070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_4 Fer4_9 Fer4_16 Fer4_8 Fer4_3 Fer4_17 Fer4_13 Fer4_ETF_QO Usp-48 Motif Other DBs NCBI-ProteinID:  AZR72818 UniProt:  A0A3Q9HPT1 LinkDB All DBs Position complement(1137344..1137553) Genome browser AA seq 69 aa AA seqDB search MARRKGKVSIRSEWCKGCNICVSFCPTGVLALEKNVAVLVAPEKCVGCMLCELRCPDYAI SVEVVKNDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggccaggcggaaaggcaaggtttctattagatcagaatggtgtaaaggatgcaatata tgtgtctctttctgtccaaccggagtattggcattagagaaaaatgttgcagttttagta gctcctgaaaaatgtgttggatgtatgttatgtgaactgcgctgtcctgattatgcaatt tctgttgaggtggtgaagaatgatggctga

DBGET integrated database retrieval system