Archaeoglobus fulgidus DSM 4304: AF_1941 Help Entry AF_1941           CDS       T00011                                  Name (GenBank) conserved hypothetical protein   KO K23264   phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3] Organism afu  Archaeoglobus fulgidus DSM 4304 Pathway afu00230   Purine metabolism afu01100   Metabolic pathways afu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afu00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     AF_1941 Enzymes [BR:afu01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor     6.3.5.3  phosphoribosylformylglycinamidine synthase      AF_1941 SSDB OrthologParalogGFIT Motif Pfam:  PurS DpnD-PcfM Motif Other DBs NCBI-ProteinID:  AAB89310 UniProt:  O28338 LinkDB All DBs Position complement(1741354..1741596) Genome browser AA seq 80 aa AA seqDB search MIADVYIELKEGVADPEGEATLKALRLLGFKRVKKVSTVKVFRIDIEARSREEAEREIAE MCEKLLANPVIQKYSIVWRE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattgcagacgtttacatcgagctcaaggagggcgttgctgaccctgaaggtgaggcg acgctcaaagctctaaggctgcttggctttaagagggttaagaaggtctcaaccgtgaag gtttttcgaattgacatcgaagcgagaagcagggaggaggcggagagggagattgccgag atgtgcgagaagctcctcgccaaccctgtaattcagaagtacagcatagtctggagagag tga

DBGET integrated database retrieval system