Archaeoglobus fulgidus DSM 4304: AF_2043 Help Entry AF_2043           CDS       T00011                                  Name (GenBank) conserved hypothetical protein   KO K09739   dihydroneopterin aldolase [EC:4.1.2.25] Organism afu  Archaeoglobus fulgidus DSM 4304 Pathway afu00790   Folate biosynthesis afu01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:afu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AF_2043 Enzymes [BR:afu01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AF_2043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHNA Motif Other DBs NCBI-ProteinID:  AAB89221 UniProt:  O28236 LinkDB All DBs Position complement(1843933..1844118) Genome browser AA seq 61 aa AA seqDB search MVDAEVRINRDKLKDVSAFGYTSLMPDMLFARVRVRVGKAEVSAVLEWDEELGYPLMRLE R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt gtggtggatgcggaggtcaggataaacagggataagcttaaagatgtatcggctttcggc tacacctccctgatgccggacatgctgttcgcgcgggtgagggttagggttggcaaagct gaggtctcggctgttctggagtgggatgaggagcttggctatcctctcatgaggcttgag cgctga

DBGET integrated database retrieval system