Archaeoglobus fulgidus DSM 4304: AF_2056 Help Entry AF_2056           CDS       T00011                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism afu  Archaeoglobus fulgidus DSM 4304 Pathway afu03060   Protein export afu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:afu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AF_2056  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AF_2056  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:afu02044]     AF_2056 Secretion system [BR:afu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AF_2056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E VIT1 DUF4404 DUF2269 DUF5798 DUF4834 PP_kinase Motif Other DBs NCBI-ProteinID:  AAB89210 UniProt:  O28223 LinkDB All DBs Position complement(1853260..1853601) Genome browser AA seq 113 aa AA seqDB search MMNLVYMQLFPGGQEWLLILLIIFVLFGASKLPEVARSLGRSMGEFKKAQKEAEMELRQF ERELREGKYTKDEKRAKLEKIARDLGIDPEGKSDEELIEEINKALPKREKAEP NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgatgaacttggtgtacatgcaactgtttccgggcgggcaggaatggttgctgatactg ctgataatatttgtgctgtttggagccagcaagctgccagaagtagccagaagtcttgga aggagcatgggagagttcaagaaagctcagaaagaagcggaaatggagctcaggcagttt gaaagggagctgagggaaggtaaatacaccaaagacgagaaaagggcgaagcttgagaaa atagcgagggacctcggaatagacccggagggaaagagcgacgaggaactgattgaggag ataaacaaagctcttccaaagagggaaaaggcagaaccgtaa

DBGET integrated database retrieval system