Aythya fuligula (tufted duck): 116487649 Help Entry 116487649         CDS       T07966                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism aful  Aythya fuligula (tufted duck) Pathway aful04814   Motor proteins aful05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aful00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     116487649 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116487649 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aful03037]     116487649 (DYNLT1)    04812 Cytoskeleton proteins [BR:aful04812]     116487649 (DYNLT1) Cilium and associated proteins [BR:aful03037]  Motile cilia and associated proteins   Dynein arm    116487649 (DYNLT1) Cytoskeleton proteins [BR:aful04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      116487649 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  116487649 NCBI-ProteinID:  XP_032040630 UniProt:  A0A6J3CQJ0 LinkDB All DBs Position 3:complement(55267230..55271749) Genome browser AA seq 113 aa AA seqDB search MDDFQAGDETSFVVDEVSNIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccaggcgggggacgagacttcctttgtcgttgatgaagtcagtaacatc attaaggaggccatagaaagtgccatcggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagcgtggtggaacaaactctaagccaactcacgaagctggggaaaccc ttcaagtatatcgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagcg agctcttgcttctgggacaactccagtgatggaacttgtactgtgagatgggagaataag accatgtattgtattgtcagtgccttcggacttgcaatatga

DBGET integrated database retrieval system