Aythya fuligula (tufted duck): 116489355 Help Entry 116489355         CDS       T07966                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism aful  Aythya fuligula (tufted duck) Pathway aful04010   MAPK signaling pathway aful04068   FoxO signaling pathway aful04081   Hormone signaling aful04114   Oocyte meiosis aful04140   Autophagy - animal aful04150   mTOR signaling pathway aful04810   Regulation of actin cytoskeleton aful04910   Insulin signaling pathway aful04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116489355 (INS)    04068 FoxO signaling pathway     116489355 (INS)    04150 mTOR signaling pathway     116489355 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     116489355 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116489355 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     116489355 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116489355 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     116489355 (INS)    04914 Progesterone-mediated oocyte maturation     116489355 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aful04052]     116489355 (INS) Cytokines and neuropeptides [BR:aful04052]  Neuropeptides   Unclassified    116489355 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  116489355 NCBI-ProteinID:  XP_032043534 UniProt:  A0A6J3CZF2 LinkDB All DBs Position 5:21630976..21634392 Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGISHAAANQHLCGSHLVEALYLVCGERGFFYSPKTRRDVEQ PLVNGPLHGEVGELPFQHEEYQKVKRGIVEQCCENPCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccggtcactgcctctcctggcccttctcgctctttctggccctggg atcagccacgcagctgccaaccagcacctctgtggctcccacttggttgaggctctctac ctggtgtgtggggagcggggtttcttctactcccccaaaacccggcgggacgttgagcag cctctagtgaacggtcccctgcatggtgaggtgggagagctgccgttccagcatgaggaa taccagaaagtcaagcgaggcatcgttgagcaatgctgtgaaaacccgtgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system