Aythya fuligula (tufted duck): 116489873 Help Entry 116489873         CDS       T07966                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism aful  Aythya fuligula (tufted duck) Brite KEGG Orthology (KO) [BR:aful00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116489873 (CD59)    04090 CD molecules [BR:aful04090]     116489873 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aful00537]     116489873 (CD59) Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116489873 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    116489873 (CD59)   Exosomal proteins of colorectal cancer cells    116489873 (CD59) CD molecules [BR:aful04090]  Proteins   116489873 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aful00537]  Antigens   116489873 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  116489873 NCBI-ProteinID:  XP_032044471 UniProt:  A0A6J3CZJ4 LinkDB All DBs Position 5:complement(48309303..48316209) Genome browser AA seq 119 aa AA seqDB search MIKMNCILLTVCIILVAFCSSGYALRCYHCENSPSLCKTNNTCLSTEDACLQMRFGKLRT SSCWKISQCNVNDIAVFYQLDNFEYFCCQQDLCNESTITAVNKAAFSIVSVMTMLWMLL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgatcaagatgaattgtatcctgttaaccgtctgcatcattctggttgctttttgtagt tcaggttatgccctaaggtgttaccactgtgagaacagcccttccttgtgcaagaccaat aatacttgcttatcaactgaagatgcttgcttgcagatgagatttggtaaactgagaacg tcctcctgctggaagatatcccagtgcaatgtgaatgatattgctgtattctaccagttg gataattttgaatacttttgctgccaacaagacttgtgcaatgagagcacaattactgca gttaacaaagcagctttcagtattgtctctgtaatgaccatgttatggatgcttctgtaa

DBGET integrated database retrieval system