Aythya fuligula (tufted duck): 116490064 Help Entry 116490064         CDS       T07966                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism aful  Aythya fuligula (tufted duck) Pathway aful04010   MAPK signaling pathway aful04012   ErbB signaling pathway aful04068   FoxO signaling pathway aful04137   Mitophagy - animal aful04140   Autophagy - animal aful04144   Endocytosis aful04150   mTOR signaling pathway aful04210   Apoptosis aful04218   Cellular senescence aful04370   VEGF signaling pathway aful04371   Apelin signaling pathway aful04510   Focal adhesion aful04540   Gap junction aful04625   C-type lectin receptor signaling pathway aful04810   Regulation of actin cytoskeleton aful04910   Insulin signaling pathway aful04912   GnRH signaling pathway aful04916   Melanogenesis aful05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116490064 (HRAS)    04012 ErbB signaling pathway     116490064 (HRAS)    04370 VEGF signaling pathway     116490064 (HRAS)    04371 Apelin signaling pathway     116490064 (HRAS)    04068 FoxO signaling pathway     116490064 (HRAS)    04150 mTOR signaling pathway     116490064 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116490064 (HRAS)    04140 Autophagy - animal     116490064 (HRAS)    04137 Mitophagy - animal     116490064 (HRAS)   09143 Cell growth and death    04210 Apoptosis     116490064 (HRAS)    04218 Cellular senescence     116490064 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     116490064 (HRAS)    04540 Gap junction     116490064 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116490064 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116490064 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     116490064 (HRAS)    04912 GnRH signaling pathway     116490064 (HRAS)    04916 Melanogenesis     116490064 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116490064 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aful04131]     116490064 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116490064 (HRAS)    04031 GTP-binding proteins [BR:aful04031]     116490064 (HRAS) Membrane trafficking [BR:aful04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116490064 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     116490064 (HRAS) Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116490064 (HRAS)   Exosomal proteins of colorectal cancer cells    116490064 (HRAS) GTP-binding proteins [BR:aful04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116490064 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  116490064 NCBI-ProteinID:  XP_032044831 UniProt:  A0A6J3D0L2 LinkDB All DBs Position 5:complement(45619529..45655169) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagctggtggcgtggggaagagcgcgctgacg atacagctcatccagaaccatttcgtcgatgagtatgaccccacgatagaggattcctac agaaagcaagtggtcattgacggagagacctgtctgctggacatcttggacacagcaggg caggaggagtacagcgccatgcgagaccagtacatgaggacgggggagggattcctctgc gtcttcgccattaacaacaccaagtccttcgaggatatccaccagtacagggagcagatc aagagggtgaaggactcagatgatgtccccatggtgctggtggggaacaaatgtgacctg ccagcccggacagtggagacgcggcaagcacaggacctggcccggagttacgggatcccc tacatagaaacgtcggccaaaaccagacagggcgtcgaggatgccttttacaccttagtg cgggagatccggcagcacaaactgcgcaagctgaatccgcccgacgagagcggccccggc tgcatgaactgtaaatgtgtcgtctcgtga

DBGET integrated database retrieval system