Aythya fuligula (tufted duck): 116490772 Help Entry 116490772         CDS       T07966                                  Symbol DBI Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism aful  Aythya fuligula (tufted duck) Pathway aful03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:aful00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     116490772 (DBI)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aful04052]     116490772 (DBI) Cytokines and neuropeptides [BR:aful04052]  Neuropeptides   Unclassified    116490772 (DBI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACBP RavZ_C bMG3 Motif Other DBs NCBI-GeneID:  116490772 NCBI-ProteinID:  XP_032046156 UniProt:  A0A6J3D450 LinkDB All DBs Position 6:31653491..31656952 Genome browser AA seq 87 aa AA seqDB search MAEAAFQKAAEEVKQLKSQPSDQEMLDVYSHYKQATVGDVNTDRPGMLDFKGKAKWDAWS ALKGMSKEDAMKAYVAKVEELKGKYGI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcggaggctgcgttccagaaggccgccgaggaggtgaagcagctcaagtcgcagcct tcggaccaggagatgctggatgtctacagccactacaagcaggccacggtgggcgacgtc aacacggatcgccctggtatgcttgacttcaaaggtaaagcaaagtgggatgcctggagt gcattgaaaggaatgtccaaagaagatgcaatgaaagcatacgtagcaaaagtggaagag ctaaagggcaaatacgggatctga

DBGET integrated database retrieval system