Aythya fuligula (tufted duck): 116491379 Help Entry 116491379         CDS       T07966                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism aful  Aythya fuligula (tufted duck) Brite KEGG Orthology (KO) [BR:aful00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aful03037]     116491379 (BBIP1) Cilium and associated proteins [BR:aful03037]  Primary cilia and associated proteins   BBSome    116491379 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  116491379 NCBI-ProteinID:  XP_032047159 UniProt:  A0A6J3D9K8 LinkDB All DBs Position 7:complement(27469627..27472091) Genome browser AA seq 67 aa AA seqDB search MPEGKAAFREVLPKQGQLSAEDVPAMVLCKPKVLPLKSVALEKLEELQRAAAEAAGRASG GAPGSQR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggaaggctgcgttccgcgaggtgctgcccaagcaagggcagctctcggcc gaggacgtccccgccatggtgctgtgcaagcccaaggtgctgcccctcaagtcggtggcg ctggagaagctggaggagctgcagcgggcggcggccgaggcggccgggagggcctcgggg ggggcgccgggctcgcagcgctag

DBGET integrated database retrieval system