Aythya fuligula (tufted duck): 116492569 Help Entry 116492569         CDS       T07966                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism aful  Aythya fuligula (tufted duck) Pathway aful04810   Regulation of actin cytoskeleton aful05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aful00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116492569 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116492569 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aful04131]     116492569 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aful04812]     116492569 (PFN2)    04147 Exosome [BR:aful04147]     116492569 (PFN2) Membrane trafficking [BR:aful04131]  Others   Actin-binding proteins    Others     116492569 (PFN2) Cytoskeleton proteins [BR:aful04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116492569 (PFN2) Exosome [BR:aful04147]  Exosomal proteins   Proteins found in most exosomes    116492569 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116492569 NCBI-ProteinID:  XP_032049251 UniProt:  A0A6J3DCP4 LinkDB All DBs Position 9:26250492..26255883 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtggggtactgcgacgccaagtacgtctgggcagccacggccggcggcatcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgagagggtttcttc accaacggtctgacccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtt gatggtgactgcacaatggacatcaggacaaagagtcaaggtggtgagccgacatacaac gttgctgtaggcagagctggccgagcattggttatagtcatgggaaaggaaggtgtccat ggagggacactcaacaagaaagcatatgaactggctttatacctgaggaggtctgacgtc taa

DBGET integrated database retrieval system