Aythya fuligula (tufted duck): 116493892 Help Entry 116493892         CDS       T07966                                  Name (RefSeq) C-C motif chemokine 14-like   KO K21083   C-C motif chemokine 17 Organism aful  Aythya fuligula (tufted duck) Pathway aful04060   Cytokine-cytokine receptor interaction aful04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116493892  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116493892  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aful04052]     116493892 Cytokines and neuropeptides [BR:aful04052]  Cytokines   Chemokines    116493892 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116493892 NCBI-ProteinID:  XP_032051416 UniProt:  A0A6J3DIY3 LinkDB All DBs Position 12:complement(9902532..9903843) Genome browser AA seq 93 aa AA seqDB search MLSTRPVLLLLLLLTFSQHCATAPYSPAECCFEYLKSPLRYDVLKDFYETPTECFYPGIV FKTKNGNKVCAKPKTLWVEKAIEKLRKKRSHTS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctcagcacaagaccagtcctgctgctcctgctgctcctcaccttctcccagcactgc gccacagctccatactcacctgcagaatgctgctttgagtacttgaagtcacctctccgg tatgatgtgctgaaggatttctacgagactcccacagagtgtttttacccaggaattgtg tttaagaccaagaacgggaacaaggtctgtgcaaaaccaaagacactttgggtggagaaa gctattgagaaactcagaaagaagaggtctcacacctcctga

DBGET integrated database retrieval system