Aythya fuligula (tufted duck): 116493911 Help Entry 116493911         CDS       T07966                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism aful  Aythya fuligula (tufted duck) Brite KEGG Orthology (KO) [BR:aful00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aful03019]     116493911    03029 Mitochondrial biogenesis [BR:aful03029]     116493911 Messenger RNA biogenesis [BR:aful03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116493911 Mitochondrial biogenesis [BR:aful03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116493911 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116493911 NCBI-ProteinID:  XP_032051454 UniProt:  A0A6J3DLK1 LinkDB All DBs Position 12:8415297..8416619 Genome browser AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactcccaggactgcccttgcgccactggtggcacctgcacctgcggggacaactgc aaatgtaaaaactgcaaatgcacgtcgtgcaaaaaaggctgctgctcctgctgccccgcg ggatgtgccaagtgcgcgcagggctgcgtctgcaaagggcccccctccgccaagtgcagc tgctgcaagtag

DBGET integrated database retrieval system