Aythya fuligula (tufted duck): 116496952 Help Entry 116496952         CDS       T07966                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism aful  Aythya fuligula (tufted duck) Pathway aful03030   DNA replication aful03082   ATP-dependent chromatin remodeling aful03410   Base excision repair aful03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:aful00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116496952 (POLE3)    03410 Base excision repair     116496952 (POLE3)    03420 Nucleotide excision repair     116496952 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116496952 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aful03032]     116496952 (POLE3)    03036 Chromosome and associated proteins [BR:aful03036]     116496952 (POLE3)    03400 DNA repair and recombination proteins [BR:aful03400]     116496952 (POLE3) Enzymes [BR:aful01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116496952 (POLE3) DNA replication proteins [BR:aful03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116496952 (POLE3) Chromosome and associated proteins [BR:aful03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     116496952 (POLE3) DNA repair and recombination proteins [BR:aful03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116496952 (POLE3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase CIS_TMP BUD22 RNA_pol_3_Rpc31 DUF4746 NOA36 CDC45 CobT Pox_Ag35 PFF1_TM ECM10 O-antigen_lig Motif Other DBs NCBI-GeneID:  116496952 NCBI-ProteinID:  XP_032056275 UniProt:  A0A6J3E289 LinkDB All DBs Position 19:complement(10396108..10398384) Genome browser AA seq 143 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNAGDVLSAMEEMEFQRFVAPLKESLEVYRREQKGKKEARKDKDKKTDSEEQDKSRE EENDDDDERMEEEEQNEEEEVDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggacctgaacctgcccaacgccgtcatcacgcgcatcatcaag gaggcgcttcctgatggggtgaacatttccaaagaagctcggagcgcgatatctcgagca gcaagtgtgttcgtgctctatgcaacgtcgtgtgcaaataactttgccatgaaggggaag aggaaaaccctgaatgctggcgatgttctctctgccatggaggaaatggagtttcagcga tttgtagcccctttgaaagaatccctggaagtttacagacgtgaacagaaaggaaagaaa gaagcgagaaaagataaagacaaaaagacagactcagaggaacaagataagagccgagag gaagagaatgatgatgatgatgaaaggatggaggaagaagaacaaaacgaggaggaggag gtggacaactga

DBGET integrated database retrieval system