Aythya fuligula (tufted duck): 116497355 Help Entry 116497355         CDS       T07966                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism aful  Aythya fuligula (tufted duck) Pathway aful04060   Cytokine-cytokine receptor interaction aful04620   Toll-like receptor signaling pathway aful04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116497355  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116497355    04623 Cytosolic DNA-sensing pathway     116497355  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aful04052]     116497355 Cytokines and neuropeptides [BR:aful04052]  Cytokines   Chemokines    116497355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116497355 NCBI-ProteinID:  XP_032056950 UniProt:  A0A6J3E487 LinkDB All DBs Position 20:543508..544537 Genome browser AA seq 90 aa AA seqDB search MKVSSVVLALLLIAASCSQMSSAPVGPDHPTCCFSYTSHKLPKKLILHYYVTSTSCSLPA LVFITKKGREVCANPSDTWVQRYLQNMKRN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctcttcagttgttctcgctcttctcctcattgcagcctcttgctcccaaatg tcctctgccccagttggacctgaccacccaacctgctgcttctcttacacatcccacaag ctcccaaagaagctcatcctgcattactacgtcaccagcaccagctgctccctgccagcc ctcgtgttcatcacaaagaaagggcgcgaagtctgtgccaatccaagtgacacctgggtg caaagatacctgcagaacatgaagcggaactga

DBGET integrated database retrieval system