Aythya fuligula (tufted duck): 116498924 Help Entry 116498924         CDS       T07966                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism aful  Aythya fuligula (tufted duck) Pathway aful04010   MAPK signaling pathway aful04012   ErbB signaling pathway aful04068   FoxO signaling pathway aful04137   Mitophagy - animal aful04140   Autophagy - animal aful04150   mTOR signaling pathway aful04210   Apoptosis aful04218   Cellular senescence aful04370   VEGF signaling pathway aful04371   Apelin signaling pathway aful04519   Cadherin signaling aful04540   Gap junction aful04625   C-type lectin receptor signaling pathway aful04810   Regulation of actin cytoskeleton aful04910   Insulin signaling pathway aful04912   GnRH signaling pathway aful04916   Melanogenesis Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116498924 (NRAS)    04012 ErbB signaling pathway     116498924 (NRAS)    04370 VEGF signaling pathway     116498924 (NRAS)    04371 Apelin signaling pathway     116498924 (NRAS)    04068 FoxO signaling pathway     116498924 (NRAS)    04150 mTOR signaling pathway     116498924 (NRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     116498924 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116498924 (NRAS)    04137 Mitophagy - animal     116498924 (NRAS)   09143 Cell growth and death    04210 Apoptosis     116498924 (NRAS)    04218 Cellular senescence     116498924 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     116498924 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116498924 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116498924 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     116498924 (NRAS)    04912 GnRH signaling pathway     116498924 (NRAS)    04916 Melanogenesis     116498924 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aful04131]     116498924 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116498924 (NRAS)    04031 GTP-binding proteins [BR:aful04031]     116498924 (NRAS) Membrane trafficking [BR:aful04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116498924 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     116498924 (NRAS) Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116498924 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    116498924 (NRAS)   Exosomal proteins of breast cancer cells    116498924 (NRAS)   Exosomal proteins of colorectal cancer cells    116498924 (NRAS) GTP-binding proteins [BR:aful04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116498924 (NRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  116498924 NCBI-ProteinID:  XP_032059306 UniProt:  A0A6J3E6L3 LinkDB All DBs Position 25 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggggccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcatac agaaagcaggttgttattgatggagagacatgcttgttagatattctggacactgcagga caggaagaatatagtgctatgcgtgatcagtacatgagaactggggaaggattcctctgt gtgtttgccattaacaacagtaaatcgtttgctgatattaacctgtacagagagcaaatc aagagagtgaaagattcagatgatgtgccaatggttctggttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc tttatagagacatctgctaaaacaagacagggtgttgaagatgctttttacacgctggtg agagagatccggcagtaccggatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattgtcctgcattgtgatgtga

DBGET integrated database retrieval system