Aythya fuligula (tufted duck): 116499681 Help Entry 116499681         CDS       T07966                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism aful  Aythya fuligula (tufted duck) Pathway aful04382   Cornified envelope formation aful05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aful00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116499681 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116499681 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116499681 (S100A10) Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of microglial cells    116499681 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 STAT_linker EFhand_Ca_insen TMP_3 Motif Other DBs NCBI-GeneID:  116499681 NCBI-ProteinID:  XP_032060378 UniProt:  A0A6J3EGD5 LinkDB All DBs Position 28:2766824..2767432 Genome browser AA seq 97 aa AA seqDB search MPSQMEQAMETLMFTFHKYAGDKNHLSKEDLRVLMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcaggccatggagacgctgatgttcaccttccacaagtacgcg ggggacaaaaaccacctgagcaaggaggacctgcgggtgctgatggagaaggagttccct ggcttcttggagaaccagcgcgaccccatggcactggacaagatcatgaaggacctggac cagtgccgtgacggcaaggtgggcttccagagcttcttctcgctggtggccgggctcacc atcgcctgcaacgactacttcgtggtgcacatgaagcagaagggcaggaagtga

DBGET integrated database retrieval system