Aythya fuligula (tufted duck): 116501196 Help Entry 116501196         CDS       T07966                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism aful  Aythya fuligula (tufted duck) Pathway aful04621   NOD-like receptor signaling pathway aful05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aful00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116501196  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116501196  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aful03110]     116501196 Chaperones and folding catalysts [BR:aful03110]  Protein folding catalysts   Protein disulfide isomerase    116501196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 AhpC-TSA Thioredoxin_2 Glutaredoxin OST3_OST6 Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  116501196 NCBI-ProteinID:  XP_032062573 UniProt:  A0A6J3EMF7 LinkDB All DBs Position Z:74053493..74060769 Genome browser AA seq 105 aa AA seqDB search MVKSVGSLSEFETELKSAGDKLVVVDFSATWCGPCKMIKPFFHSLCEKFGDVVFIEIDVD DAQDVATHCEVKCMPTFQFYKNGKMVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagagcgtgggcagcttgtctgagtttgagacagaactgaagtctgctggtgac aagcttgtagtagttgacttctcggccacatggtgtggaccatgcaaaatgatcaagcca tttttccatagtttgtgtgagaaatttggggatgtggtgttcatcgaaatcgacgtggat gacgcccaggatgttgctacacactgtgaggtgaagtgcatgccaacattccagttctac aagaacggaaagatggtgcaggaattctctggggccaataaagaaaaactggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system