Aythya fuligula (tufted duck): 116501770 Help Entry 116501770         CDS       T07966                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism aful  Aythya fuligula (tufted duck) Pathway aful04020   Calcium signaling pathway aful04070   Phosphatidylinositol signaling system aful04114   Oocyte meiosis aful04218   Cellular senescence aful04261   Adrenergic signaling in cardiomyocytes aful04270   Vascular smooth muscle contraction aful04371   Apelin signaling pathway aful04625   C-type lectin receptor signaling pathway aful04744   Phototransduction aful04910   Insulin signaling pathway aful04912   GnRH signaling pathway aful04916   Melanogenesis Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     116501770    04020 Calcium signaling pathway     116501770    04070 Phosphatidylinositol signaling system     116501770  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116501770    04218 Cellular senescence     116501770  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116501770   09152 Endocrine system    04910 Insulin signaling pathway     116501770    04912 GnRH signaling pathway     116501770    04916 Melanogenesis     116501770   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116501770    04270 Vascular smooth muscle contraction     116501770   09157 Sensory system    04744 Phototransduction     116501770  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aful01009]     116501770   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aful04131]     116501770    03036 Chromosome and associated proteins [BR:aful03036]     116501770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116501770 Protein phosphatases and associated proteins [BR:aful01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116501770 Membrane trafficking [BR:aful04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116501770 Chromosome and associated proteins [BR:aful03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116501770 Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116501770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen Dockerin_1 UPF0154 Caleosin DUF5580_M FCaBP_EF-hand SPEF2_C SurA_N_2 SurA_N_3 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  116501770 NCBI-ProteinID:  XP_032063242 UniProt:  A0A6J3EMX8 LinkDB All DBs Position 1:complement(1729316..1729765) Genome browser AA seq 149 aa AA seqDB search MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTVDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagcagatcgccgagttcaaggaggctttttcccttttc gaccgcgacggcgacggctgcatcaccaccaaggagctgggcaccgtcatgcgctcgctg gggcagaaccccaccgaggcggagctgcaggacatggtgggcgaggtggacgccgacggc agcggcaccgtcgacttccccgagttcctctcgctgatggcgaggaagatgagggactcg gacagcgaggaggagatccgcgaggccttccgcgtcttcgacaaggacggcaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag gaggtggacgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system