Aythya fuligula (tufted duck): 116502371 Help Entry 116502371         CDS       T07966                                  Name (RefSeq) histone H2A-IV   KO K11251   histone H2A Organism aful  Aythya fuligula (tufted duck) Pathway aful03082   ATP-dependent chromatin remodeling aful04217   Necroptosis Brite KEGG Orthology (KO) [BR:aful00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116502371  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116502371  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aful03036]     116502371   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aful04147]     116502371 Chromosome and associated proteins [BR:aful03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116502371 Exosome [BR:aful04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116502371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  116502371 NCBI-ProteinID:  XP_032064149 UniProt:  A0A6J3EK20 LinkDB All DBs Position 1:44390374..44391066 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TDSHKAKAK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgcgggaagcagggcgggaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctggctatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcgcagggcggggtgctgcccaacatccaggctgtgctgctgcccaagaag accgacagccacaaggctaaggccaagtga

DBGET integrated database retrieval system