Aequoribacter fuscus: EYZ66_10740 Help Entry EYZ66_10740       CDS       T07243                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism afus  Aequoribacter fuscus Brite KEGG Orthology (KO) [BR:afus00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:afus03036]     EYZ66_10740 Chromosome and associated proteins [BR:afus03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EYZ66_10740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DUF2897 Wzz TMIE Motif Other DBs NCBI-ProteinID:  QHJ88736 LinkDB All DBs Position complement(2401334..2401603) Genome browser AA seq 89 aa AA seqDB search MSLRLWQVILLALAVVLSGFAVIGVTQQTRNVTTQLQVAESRQWFLRDESSRLLLELSTY TRMDRVDDISADMDMVAASPTQIRVVPSE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtttgcgactgtggcaagtcatattgctggcactggctgtggtgttgagcgggttt gccgttattggtgtcacccagcaaacgcgtaatgtgaccacgcagctccaggtagccgag agtcgccagtggtttttacgtgacgagtcgagtcgcctgttgctcgagttgagtacgtac acgcgcatggatcgcgtcgacgatatcagtgccgacatggacatggtggcagcatcaccg actcaaatacgggtggtgcccagtgagtag

DBGET integrated database retrieval system