Ammonicoccus fulvus: AADG42_08650 Help Entry AADG42_08650      CDS       T10995                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism afuv  Ammonicoccus fulvus Pathway afuv00361   Chlorocyclohexane and chlorobenzene degradation afuv00362   Benzoate degradation afuv00623   Toluene degradation afuv01100   Metabolic pathways afuv01120   Microbial metabolism in diverse environments afuv01220   Degradation of aromatic compounds Brite Enzymes [BR:afuv01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      AADG42_08650     1.14.13.244  phenol 2-monooxygenase (NADH)      AADG42_08650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XAN07359 LinkDB All DBs Position complement(1822557..1822847) Genome browser AA seq 96 aa AA seqDB search MTEAKRRPRVASIDIQDTDTNRPVIDAIVEDNPGCDTVTMPGLVKIRREGGLHITRETVE KHVGGEWETSEIQLAIVSMSGNLDIEEDYIDIAWKR NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgaagccaagcgccgcccgcgcgttgcgagcatcgacatccaggacaccgacacc aaccgccccgtcatcgacgccatcgtcgaggacaacccgggctgcgacaccgtcaccatg ccgggcctcgtgaagatccggcgggagggtggcctccacatcacccgcgaaaccgtcgag aagcacgtcggcggcgagtgggagacctccgagatccagctggcgatcgtctcgatgtcc ggaaacctggacatcgaagaggactacatcgatatcgcctggaagcgctga

DBGET integrated database retrieval system