Aspergillus flavus: AFLA_000820 Help Entry AFLA_000820       CDS       T01090                                  Name (GenBank) hypothetical protein   KO K10418   dynein light chain LC8-type Organism afv  Aspergillus flavus Pathway afv04517   IgSF CAM signaling afv04814   Motor proteins Brite KEGG Orthology (KO) [BR:afv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     AFLA_000820  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     AFLA_000820  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:afv03037]     AFLA_000820    04812 Cytoskeleton proteins [BR:afv04812]     AFLA_000820 Cilium and associated proteins [BR:afv03037]  Motile cilia and associated proteins   Dynein arm    AFLA_000820 Cytoskeleton proteins [BR:afv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      AFLA_000820 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RhoGEF67_u1 RFC1 Motif Other DBs NCBI-ProteinID:  KAF7619188 LinkDB All DBs AA seq 94 aa AA seqDB search MSSEKKDKLEPQIKSVDMTEDMQQEAVEVAIEAMEKYHIEKDIAQYIKREFDSRKGATWH CVVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcttccgaaaagaaggataagctcgagccgcaaatcaagtccgtcgatatgacggag gatatgcagcaggaagctgtcgaagttgcgatcgaggcaatggagaagtaccacattgag aaggacattgcccagtacatcaagcgagagtttgactcgcgcaaaggagctacatggcat tgtgtcgtagggaggaatttcggaagctttgttacacacgagacgaaacacttcatctac ttctacctcggacactgcgccattctcctcttcaagacccaataa

DBGET integrated database retrieval system