Aspergillus flavus: AFLA_002021 Help Entry AFLA_002021       CDS       T01090                                  Name (GenBank) hypothetical protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism afv  Aspergillus flavus Pathway afv03018   RNA degradation afv03040   Spliceosome Brite KEGG Orthology (KO) [BR:afv00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     AFLA_002021   09123 Folding, sorting and degradation    03018 RNA degradation     AFLA_002021  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:afv03019]     AFLA_002021    03041 Spliceosome [BR:afv03041]     AFLA_002021 Messenger RNA biogenesis [BR:afv03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      AFLA_002021   mRNA degradation factors    5'-3' decay     Lsm complex      AFLA_002021 Spliceosome [BR:afv03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     AFLA_002021  Complex C   U2 snRNP components     AFLA_002021 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM LRR_9 Hfq SM-ATX Motif Other DBs NCBI-ProteinID:  KAF7625147 LinkDB All DBs AA seq 98 aa AA seqDB search MLFFSFFKTLTNQTVIIELKNDIRIRGTLKSVDQYLNIKLDDVDVLDLDKYPHLSSVKNM FIRGSVVRYVVLPRSEVDVGLLEDATRREAANQAGKAR NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctcttcttcagtttcttcaagaccctcacaaaccagaccgtgatcatcgagctcaaa aatgacattcgcatccgcggaacactgaaatccgtcgaccaatacctcaacatcaagctc gacgatgtcgacgtcctggacctggacaagtaccctcacctgtcatccgtgaagaacatg ttcatccgtggtagcgtggttcgctacgttgttttaccccggtcggaagtggatgtcggg ttgctggaggatgccacaagacgagaggcagccaaccaagccggaaaagcccggtga

DBGET integrated database retrieval system