Aspergillus flavus: AFLA_006832 Help Entry AFLA_006832       CDS       T01090                                  Name (GenBank) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism afv  Aspergillus flavus Pathway afv00510   N-Glycan biosynthesis afv00513   Various types of N-glycan biosynthesis afv01100   Metabolic pathways afv04141   Protein processing in endoplasmic reticulum Module afv_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:afv00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     AFLA_006832    00513 Various types of N-glycan biosynthesis     AFLA_006832  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AFLA_006832 SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Bac_rhodopsin Motif Other DBs NCBI-ProteinID:  KAF7617922 LinkDB All DBs AA seq 78 aa AA seqDB search MISDDDLHRLAVFLGSCAMMMIVLYHFLEVNAKDSGVEDASDVKKSAAASQESVAASPST VPAAAAGGSSAIGGEKDR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatttccgacgacgaccttcaccgccttgctgtctttctcggctcttgcgcgatgatg atgattgttctctaccacttcctcgaagtcaatgccaaggatagtggagtcgaggatgca agtgatgtgaagaagtcggccgctgcgtctcaggagtcagttgctgctagcccttcgaca gtacctgcagcggccgccggcggttcgtcagccatcggaggagaaaaagaccggtag

DBGET integrated database retrieval system