Aspergillus flavus: AFLA_010361 Help Entry AFLA_010361       CDS       T01090                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism afv  Aspergillus flavus Pathway afv03060   Protein export afv04141   Protein processing in endoplasmic reticulum afv04145   Phagosome Brite KEGG Orthology (KO) [BR:afv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AFLA_010361    04141 Protein processing in endoplasmic reticulum     AFLA_010361  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AFLA_010361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afv04131]     AFLA_010361   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:afv02044]     AFLA_010361 Membrane trafficking [BR:afv04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     AFLA_010361 Secretion system [BR:afv02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    AFLA_010361 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  KAF7623049 LinkDB All DBs AA seq 70 aa AA seqDB search MSETLQELADIPKDFLREGTLFVRRCTKPDKREFIKISQAVGMGFLIMGAIGYFIKLIHI PVNNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaaccctccaagagctcgccgacatccccaaggacttcctccgtgagggaacc ctcttcgtccgcagatgcaccaagcccgacaagcgcgaattcatcaagatcagccaggcc gtcggcatgggcttccttatcatgggtgccattggttacttcattaaattaatacacatt cccgtcaacaacatccttgtcggtggcgcataa

DBGET integrated database retrieval system