Aspergillus flavus: AFLA_010718 Help Entry AFLA_010718       CDS       T01090                                  Name (GenBank) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism afv  Aspergillus flavus Pathway afv03083   Polycomb repressive complex afv04111   Cell cycle - yeast afv04120   Ubiquitin mediated proteolysis afv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:afv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AFLA_010718    04120 Ubiquitin mediated proteolysis     AFLA_010718   09126 Chromosome    03083 Polycomb repressive complex     AFLA_010718  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     AFLA_010718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afv04131]     AFLA_010718    04121 Ubiquitin system [BR:afv04121]     AFLA_010718    03036 Chromosome and associated proteins [BR:afv03036]     AFLA_010718 Membrane trafficking [BR:afv04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AFLA_010718 Ubiquitin system [BR:afv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AFLA_010718    Cul7 complex      AFLA_010718 Chromosome and associated proteins [BR:afv03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AFLA_010718   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AFLA_010718 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-ProteinID:  KAF7630089 LinkDB All DBs AA seq 161 aa AA seqDB search MATPTLTFTSSDGVDIPVERDVAERSQLIKNMLEDLGETGEPIPIPNVNEAVLKKVIEWC THHKNDPPSTGDDDDSRRKTTDIDEWDQKFMQVDQEMLFEIILAANYLDIKGLLDVGCKT VANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEDR NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggccactcctactctaaccttcacgagctccgacggcgttgacatccctgtcgaacgt gatgtcgccgaacgctcgcagctcattaagaacatgctcgaagacttgggtgaaactgga gagcccattcctatccccaacgtcaacgaagccgttctgaagaaggtcattgaatggtgc acccatcataagaacgaccctcccagcaccggcgatgacgatgattcccgccgcaagact acggatatcgacgagtgggatcagaagttcatgcaggttgatcaggaaatgcttttcgaa ataattctggccgccaactaccttgacattaagggactacttgatgttggctgcaagacc gttgcgaatatgatcaagggcaagtctcctgaggagattcgtaagaccttcaatatccag aacgattttacacccgaggaggaggatcagattcgtcgcgagaatgaatgggcagaggac cgctaa

DBGET integrated database retrieval system