Alicyclobacillus mengziensis: JZ786_11880 Help Entry JZ786_11880       CDS       T07322                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afx  Alicyclobacillus mengziensis Pathway afx01100   Metabolic pathways afx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JZ786_11880    00074 Mycolic acid biosynthesis     JZ786_11880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JZ786_11880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc DUF7080 Motif Other DBs NCBI-ProteinID:  QSO49530 UniProt:  A0A9X7W396 LinkDB All DBs Position 2560518..2560751 Genome browser AA seq 77 aa AA seqDB search MSDTLSRVKSIIVDRLGVDEAKIVPTATFKDDLGADSLDVVELIMELEDEFDMEISDEDA EKIKTVGDVVTYIDAHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgatacattgtctcgcgtgaagagcatcattgtggaccgcctcggtgttgatgaa gcaaaaatcgttccgacggctacgttcaaagatgatctcggtgctgattcactcgatgtt gtcgagctcatcatggaactcgaagacgagtttgatatggagatctcagacgaagatgct gaaaagattaaaactgttggtgatgtagttacatatattgacgcgcatctgtaa

DBGET integrated database retrieval system