KEGG   Alicyclobacillus mengziensis: JZ786_12175
Entry
JZ786_12175       CDS       T07322                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
afx  Alicyclobacillus mengziensis
Pathway
afx02020  Two-component system
afx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:afx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JZ786_12175
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    JZ786_12175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:afx02022]
    JZ786_12175
   02035 Bacterial motility proteins [BR:afx02035]
    JZ786_12175
Two-component system [BR:afx02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   JZ786_12175
Bacterial motility proteins [BR:afx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    JZ786_12175
SSDB
Motif
Pfam: Response_reg TadZ_N
Other DBs
NCBI-ProteinID: QSO49577
UniProt: A0A9X7Z8G2
LinkDB
Position
2616733..2617095
AA seq 120 aa
MSKRVLVVDDAAFMRMMIKDILTKNGYDVVGEAVDGTQAVDKYQELHPDLVTMDITMPEM
DGIEALKRIRSIDPNAKVVMCSAMGQQAMVIDAIQAGARDFVVKPFQADRVLESIRKVLG
NT seq 363 nt   +upstreamnt  +downstreamnt
gtgagcaagcgtgttcttgtagtggacgatgcggcattcatgcgcatgatgattaaggac
attttgaccaagaatggctacgatgtcgtcggtgaagccgtcgatggaacccaagccgtc
gacaagtaccaggagttgcatcctgacttggtgacaatggacatcacgatgcctgaaatg
gacggtatcgaagcgctgaagcggatccgctcgattgacccaaacgcgaaagtggtcatg
tgttctgccatgggccaacaggccatggtcattgatgcaatccaagctggagcgcgggac
tttgtggtcaagccatttcaggccgacagggtgctcgagtcgattcgtaaggtcctgggg
taa

DBGET integrated database retrieval system