Acidihalobacter ferrooxydans: BW247_01835 Help Entry BW247_01835       CDS       T09791                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism afy  Acidihalobacter ferrooxydans Pathway afy00290   Valine, leucine and isoleucine biosynthesis afy00650   Butanoate metabolism afy00660   C5-Branched dibasic acid metabolism afy00770   Pantothenate and CoA biosynthesis afy01100   Metabolic pathways afy01110   Biosynthesis of secondary metabolites afy01210   2-Oxocarboxylic acid metabolism afy01230   Biosynthesis of amino acids Module afy_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine afy_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:afy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BW247_01835    00660 C5-Branched dibasic acid metabolism     BW247_01835   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BW247_01835   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BW247_01835 Enzymes [BR:afy01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BW247_01835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  APZ41993 UniProt:  A0A1P8UDU6 LinkDB All DBs Position 392342..392596 Genome browser AA seq 84 aa AA seqDB search MNHELQIIARPQTGALERILRTLRVRGFEVQRMHADFDTARERFHLGVWLQGERAPDVLE RQLLRLAEVETVLAVHASTRSAAV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatcacgaattgcagattatcgcccgcccccagactggcgcactggagcgcattctg cgcaccttgcgcgtgcgcggcttcgaggtgcagcgcatgcacgcggatttcgataccgcg cgcgaacgctttcacctgggcgtgtggttgcagggcgaacgggcgcctgacgtgctggag cgccagttgttgcgactggccgaggtcgagacggtattggccgtgcacgccagcacacgc agcgcagcggtctga

DBGET integrated database retrieval system