KEGG   Antechinus flavipes (yellow-footed antechinus): 127538128
Entry
127538128         CDS       T08818                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ras-like protein
  KO
K07827  GTPase KRas
Organism
afz  Antechinus flavipes (yellow-footed antechinus)
Pathway
afz01521  EGFR tyrosine kinase inhibitor resistance
afz01522  Endocrine resistance
afz04010  MAPK signaling pathway
afz04012  ErbB signaling pathway
afz04014  Ras signaling pathway
afz04015  Rap1 signaling pathway
afz04062  Chemokine signaling pathway
afz04068  FoxO signaling pathway
afz04071  Sphingolipid signaling pathway
afz04072  Phospholipase D signaling pathway
afz04137  Mitophagy - animal
afz04140  Autophagy - animal
afz04150  mTOR signaling pathway
afz04151  PI3K-Akt signaling pathway
afz04210  Apoptosis
afz04211  Longevity regulating pathway
afz04213  Longevity regulating pathway - multiple species
afz04218  Cellular senescence
afz04360  Axon guidance
afz04370  VEGF signaling pathway
afz04371  Apelin signaling pathway
afz04519  Cadherin signaling
afz04540  Gap junction
afz04550  Signaling pathways regulating pluripotency of stem cells
afz04625  C-type lectin receptor signaling pathway
afz04650  Natural killer cell mediated cytotoxicity
afz04660  T cell receptor signaling pathway
afz04662  B cell receptor signaling pathway
afz04664  Fc epsilon RI signaling pathway
afz04714  Thermogenesis
afz04720  Long-term potentiation
afz04722  Neurotrophin signaling pathway
afz04725  Cholinergic synapse
afz04726  Serotonergic synapse
afz04730  Long-term depression
afz04810  Regulation of actin cytoskeleton
afz04910  Insulin signaling pathway
afz04912  GnRH signaling pathway
afz04914  Progesterone-mediated oocyte maturation
afz04915  Estrogen signaling pathway
afz04916  Melanogenesis
afz04917  Prolactin signaling pathway
afz04919  Thyroid hormone signaling pathway
afz04921  Oxytocin signaling pathway
afz04926  Relaxin signaling pathway
afz04929  GnRH secretion
afz04933  AGE-RAGE signaling pathway in diabetic complications
afz04935  Growth hormone synthesis, secretion and action
afz04960  Aldosterone-regulated sodium reabsorption
afz05010  Alzheimer disease
afz05022  Pathways of neurodegeneration - multiple diseases
afz05034  Alcoholism
afz05160  Hepatitis C
afz05161  Hepatitis B
afz05163  Human cytomegalovirus infection
afz05165  Human papillomavirus infection
afz05166  Human T-cell leukemia virus 1 infection
afz05167  Kaposi sarcoma-associated herpesvirus infection
afz05170  Human immunodeficiency virus 1 infection
afz05200  Pathways in cancer
afz05203  Viral carcinogenesis
afz05205  Proteoglycans in cancer
afz05206  MicroRNAs in cancer
afz05207  Chemical carcinogenesis - receptor activation
afz05208  Chemical carcinogenesis - reactive oxygen species
afz05210  Colorectal cancer
afz05211  Renal cell carcinoma
afz05212  Pancreatic cancer
afz05213  Endometrial cancer
afz05214  Glioma
afz05215  Prostate cancer
afz05216  Thyroid cancer
afz05218  Melanoma
afz05219  Bladder cancer
afz05220  Chronic myeloid leukemia
afz05221  Acute myeloid leukemia
afz05223  Non-small cell lung cancer
afz05224  Breast cancer
afz05225  Hepatocellular carcinoma
afz05226  Gastric cancer
afz05230  Central carbon metabolism in cancer
afz05231  Choline metabolism in cancer
afz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
afz05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:afz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127538128
   04012 ErbB signaling pathway
    127538128
   04014 Ras signaling pathway
    127538128
   04015 Rap1 signaling pathway
    127538128
   04370 VEGF signaling pathway
    127538128
   04371 Apelin signaling pathway
    127538128
   04068 FoxO signaling pathway
    127538128
   04072 Phospholipase D signaling pathway
    127538128
   04071 Sphingolipid signaling pathway
    127538128
   04151 PI3K-Akt signaling pathway
    127538128
   04150 mTOR signaling pathway
    127538128
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    127538128
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    127538128
   04137 Mitophagy - animal
    127538128
  09143 Cell growth and death
   04210 Apoptosis
    127538128
   04218 Cellular senescence
    127538128
  09144 Cellular community - eukaryotes
   04540 Gap junction
    127538128
   04550 Signaling pathways regulating pluripotency of stem cells
    127538128
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    127538128
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    127538128
   04650 Natural killer cell mediated cytotoxicity
    127538128
   04660 T cell receptor signaling pathway
    127538128
   04662 B cell receptor signaling pathway
    127538128
   04664 Fc epsilon RI signaling pathway
    127538128
   04062 Chemokine signaling pathway
    127538128
  09152 Endocrine system
   04910 Insulin signaling pathway
    127538128
   04929 GnRH secretion
    127538128
   04912 GnRH signaling pathway
    127538128
   04915 Estrogen signaling pathway
    127538128
   04914 Progesterone-mediated oocyte maturation
    127538128
   04917 Prolactin signaling pathway
    127538128
   04921 Oxytocin signaling pathway
    127538128
   04926 Relaxin signaling pathway
    127538128
   04935 Growth hormone synthesis, secretion and action
    127538128
   04919 Thyroid hormone signaling pathway
    127538128
   04916 Melanogenesis
    127538128
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    127538128
  09156 Nervous system
   04725 Cholinergic synapse
    127538128
   04726 Serotonergic synapse
    127538128
   04720 Long-term potentiation
    127538128
   04730 Long-term depression
    127538128
   04722 Neurotrophin signaling pathway
    127538128
  09158 Development and regeneration
   04360 Axon guidance
    127538128
  09149 Aging
   04211 Longevity regulating pathway
    127538128
   04213 Longevity regulating pathway - multiple species
    127538128
  09159 Environmental adaptation
   04714 Thermogenesis
    127538128
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    127538128
   05206 MicroRNAs in cancer
    127538128
   05205 Proteoglycans in cancer
    127538128
   05207 Chemical carcinogenesis - receptor activation
    127538128
   05208 Chemical carcinogenesis - reactive oxygen species
    127538128
   05203 Viral carcinogenesis
    127538128
   05230 Central carbon metabolism in cancer
    127538128
   05231 Choline metabolism in cancer
    127538128
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    127538128
  09162 Cancer: specific types
   05210 Colorectal cancer
    127538128
   05212 Pancreatic cancer
    127538128
   05225 Hepatocellular carcinoma
    127538128
   05226 Gastric cancer
    127538128
   05214 Glioma
    127538128
   05216 Thyroid cancer
    127538128
   05221 Acute myeloid leukemia
    127538128
   05220 Chronic myeloid leukemia
    127538128
   05218 Melanoma
    127538128
   05211 Renal cell carcinoma
    127538128
   05219 Bladder cancer
    127538128
   05215 Prostate cancer
    127538128
   05213 Endometrial cancer
    127538128
   05224 Breast cancer
    127538128
   05223 Non-small cell lung cancer
    127538128
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127538128
   05170 Human immunodeficiency virus 1 infection
    127538128
   05161 Hepatitis B
    127538128
   05160 Hepatitis C
    127538128
   05163 Human cytomegalovirus infection
    127538128
   05167 Kaposi sarcoma-associated herpesvirus infection
    127538128
   05165 Human papillomavirus infection
    127538128
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127538128
   05022 Pathways of neurodegeneration - multiple diseases
    127538128
  09165 Substance dependence
   05034 Alcoholism
    127538128
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127538128
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    127538128
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    127538128
   01522 Endocrine resistance
    127538128
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afz04131]
    127538128
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:afz04031]
    127538128
Membrane trafficking [BR:afz04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    127538128
GTP-binding proteins [BR:afz04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    127538128
SSDB
Motif
Pfam: Ras Roc Arf FeoB_N RsgA_GTPase GTP_EFTU MMR_HSR1 ATP_bind_1 CapB_C RHG35-p190PhoGP_pG1
Other DBs
NCBI-GeneID: 127538128
NCBI-ProteinID: XP_051817652
LinkDB
Position
5:299505793..299506418
AA seq 208 aa
MTSCVHTSIGDPDXRRTKMYKLAVMGTGSVGKSALTMQFLENRFVTEYDPTIEDSYRKQT
VVDEEPCQLDILDTTDIEEHYPLRDQFMLWGEGFLFVYAVNDRNSFENLNFFWQHLRRLK
QTARVPVVLVANKVDVTDRLVETTLGQEVARSLGVPYVETSAKTGQGVEQAFHELVREIR
RIRAEEELKRVSNTEEKEACGCKCCTIQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atgacttcttgtgtccatacctccataggtgatccagacnaacgcagaaccaagatgtat
aagttggcggtgatgggcactggttctgtgggcaagagtgcactgaccatgcagtttctt
gagaatcgttttgtgaccgagtatgaccccaccattgaagattcctaccggaagcaaaca
gtggtggacgaagagccgtgccagctggacatcctggataccacagacatagaagagcac
tatcctctgagagaccagttcatgctttggggagagggattcctctttgtctatgcagta
aatgaccgcaactcttttgagaatttgaatttcttttggcaacatctgcggaggctcaag
caaaccgcccgagtacctgtggtgttggtggccaacaaagtagatgtgaccgacaggctt
gtggaaaccacactgggccaggaggtggccaggagtttaggggtcccttatgtggagaca
tcagccaagactgggcaaggtgtggagcaagccttccatgagctggttcgtgaaattcgg
aggatccgagctgaggaggaactcaagagagtctctaatactgaggagaaggaggcttgt
gggtgcaaatgttgcaccatccagtga

DBGET integrated database retrieval system