KEGG   Antechinus flavipes (yellow-footed antechinus): 127556083
Entry
127556083         CDS       T08818                                 
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
afz  Antechinus flavipes (yellow-footed antechinus)
Pathway
afz01521  EGFR tyrosine kinase inhibitor resistance
afz01522  Endocrine resistance
afz01524  Platinum drug resistance
afz04010  MAPK signaling pathway
afz04012  ErbB signaling pathway
afz04014  Ras signaling pathway
afz04015  Rap1 signaling pathway
afz04022  cGMP-PKG signaling pathway
afz04024  cAMP signaling pathway
afz04062  Chemokine signaling pathway
afz04066  HIF-1 signaling pathway
afz04068  FoxO signaling pathway
afz04071  Sphingolipid signaling pathway
afz04072  Phospholipase D signaling pathway
afz04114  Oocyte meiosis
afz04140  Autophagy - animal
afz04148  Efferocytosis
afz04150  mTOR signaling pathway
afz04151  PI3K-Akt signaling pathway
afz04210  Apoptosis
afz04218  Cellular senescence
afz04261  Adrenergic signaling in cardiomyocytes
afz04270  Vascular smooth muscle contraction
afz04350  TGF-beta signaling pathway
afz04360  Axon guidance
afz04370  VEGF signaling pathway
afz04371  Apelin signaling pathway
afz04380  Osteoclast differentiation
afz04510  Focal adhesion
afz04517  IgSF CAM signaling
afz04520  Adherens junction
afz04540  Gap junction
afz04550  Signaling pathways regulating pluripotency of stem cells
afz04611  Platelet activation
afz04613  Neutrophil extracellular trap formation
afz04620  Toll-like receptor signaling pathway
afz04621  NOD-like receptor signaling pathway
afz04625  C-type lectin receptor signaling pathway
afz04650  Natural killer cell mediated cytotoxicity
afz04657  IL-17 signaling pathway
afz04658  Th1 and Th2 cell differentiation
afz04659  Th17 cell differentiation
afz04660  T cell receptor signaling pathway
afz04662  B cell receptor signaling pathway
afz04664  Fc epsilon RI signaling pathway
afz04666  Fc gamma R-mediated phagocytosis
afz04668  TNF signaling pathway
afz04713  Circadian entrainment
afz04720  Long-term potentiation
afz04722  Neurotrophin signaling pathway
afz04723  Retrograde endocannabinoid signaling
afz04724  Glutamatergic synapse
afz04725  Cholinergic synapse
afz04726  Serotonergic synapse
afz04730  Long-term depression
afz04810  Regulation of actin cytoskeleton
afz04910  Insulin signaling pathway
afz04912  GnRH signaling pathway
afz04914  Progesterone-mediated oocyte maturation
afz04915  Estrogen signaling pathway
afz04916  Melanogenesis
afz04917  Prolactin signaling pathway
afz04919  Thyroid hormone signaling pathway
afz04921  Oxytocin signaling pathway
afz04926  Relaxin signaling pathway
afz04928  Parathyroid hormone synthesis, secretion and action
afz04929  GnRH secretion
afz04930  Type II diabetes mellitus
afz04933  AGE-RAGE signaling pathway in diabetic complications
afz04934  Cushing syndrome
afz04935  Growth hormone synthesis, secretion and action
afz04960  Aldosterone-regulated sodium reabsorption
afz05010  Alzheimer disease
afz05020  Prion disease
afz05022  Pathways of neurodegeneration - multiple diseases
afz05034  Alcoholism
afz05132  Salmonella infection
afz05133  Pertussis
afz05135  Yersinia infection
afz05140  Leishmaniasis
afz05142  Chagas disease
afz05145  Toxoplasmosis
afz05152  Tuberculosis
afz05160  Hepatitis C
afz05161  Hepatitis B
afz05163  Human cytomegalovirus infection
afz05164  Influenza A
afz05165  Human papillomavirus infection
afz05166  Human T-cell leukemia virus 1 infection
afz05167  Kaposi sarcoma-associated herpesvirus infection
afz05170  Human immunodeficiency virus 1 infection
afz05171  Coronavirus disease - COVID-19
afz05200  Pathways in cancer
afz05203  Viral carcinogenesis
afz05205  Proteoglycans in cancer
afz05206  MicroRNAs in cancer
afz05207  Chemical carcinogenesis - receptor activation
afz05208  Chemical carcinogenesis - reactive oxygen species
afz05210  Colorectal cancer
afz05211  Renal cell carcinoma
afz05212  Pancreatic cancer
afz05213  Endometrial cancer
afz05214  Glioma
afz05215  Prostate cancer
afz05216  Thyroid cancer
afz05218  Melanoma
afz05219  Bladder cancer
afz05220  Chronic myeloid leukemia
afz05221  Acute myeloid leukemia
afz05223  Non-small cell lung cancer
afz05224  Breast cancer
afz05225  Hepatocellular carcinoma
afz05226  Gastric cancer
afz05230  Central carbon metabolism in cancer
afz05231  Choline metabolism in cancer
afz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
afz05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:afz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127556083
   04012 ErbB signaling pathway
    127556083
   04014 Ras signaling pathway
    127556083
   04015 Rap1 signaling pathway
    127556083
   04350 TGF-beta signaling pathway
    127556083
   04370 VEGF signaling pathway
    127556083
   04371 Apelin signaling pathway
    127556083
   04668 TNF signaling pathway
    127556083
   04066 HIF-1 signaling pathway
    127556083
   04068 FoxO signaling pathway
    127556083
   04072 Phospholipase D signaling pathway
    127556083
   04071 Sphingolipid signaling pathway
    127556083
   04024 cAMP signaling pathway
    127556083
   04022 cGMP-PKG signaling pathway
    127556083
   04151 PI3K-Akt signaling pathway
    127556083
   04150 mTOR signaling pathway
    127556083
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    127556083
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    127556083
   04148 Efferocytosis
    127556083
  09143 Cell growth and death
   04114 Oocyte meiosis
    127556083
   04210 Apoptosis
    127556083
   04218 Cellular senescence
    127556083
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    127556083
   04520 Adherens junction
    127556083
   04540 Gap junction
    127556083
   04550 Signaling pathways regulating pluripotency of stem cells
    127556083
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    127556083
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    127556083
   04613 Neutrophil extracellular trap formation
    127556083
   04620 Toll-like receptor signaling pathway
    127556083
   04621 NOD-like receptor signaling pathway
    127556083
   04625 C-type lectin receptor signaling pathway
    127556083
   04650 Natural killer cell mediated cytotoxicity
    127556083
   04660 T cell receptor signaling pathway
    127556083
   04658 Th1 and Th2 cell differentiation
    127556083
   04659 Th17 cell differentiation
    127556083
   04657 IL-17 signaling pathway
    127556083
   04662 B cell receptor signaling pathway
    127556083
   04664 Fc epsilon RI signaling pathway
    127556083
   04666 Fc gamma R-mediated phagocytosis
    127556083
   04062 Chemokine signaling pathway
    127556083
  09152 Endocrine system
   04910 Insulin signaling pathway
    127556083
   04929 GnRH secretion
    127556083
   04912 GnRH signaling pathway
    127556083
   04915 Estrogen signaling pathway
    127556083
   04914 Progesterone-mediated oocyte maturation
    127556083
   04917 Prolactin signaling pathway
    127556083
   04921 Oxytocin signaling pathway
    127556083
   04926 Relaxin signaling pathway
    127556083
   04935 Growth hormone synthesis, secretion and action
    127556083
   04919 Thyroid hormone signaling pathway
    127556083
   04928 Parathyroid hormone synthesis, secretion and action
    127556083
   04916 Melanogenesis
    127556083
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    127556083
   04270 Vascular smooth muscle contraction
    127556083
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    127556083
  09156 Nervous system
   04724 Glutamatergic synapse
    127556083
   04725 Cholinergic synapse
    127556083
   04726 Serotonergic synapse
    127556083
   04720 Long-term potentiation
    127556083
   04730 Long-term depression
    127556083
   04723 Retrograde endocannabinoid signaling
    127556083
   04722 Neurotrophin signaling pathway
    127556083
  09158 Development and regeneration
   04360 Axon guidance
    127556083
   04380 Osteoclast differentiation
    127556083
  09159 Environmental adaptation
   04713 Circadian entrainment
    127556083
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    127556083
   05206 MicroRNAs in cancer
    127556083
   05205 Proteoglycans in cancer
    127556083
   05207 Chemical carcinogenesis - receptor activation
    127556083
   05208 Chemical carcinogenesis - reactive oxygen species
    127556083
   05203 Viral carcinogenesis
    127556083
   05230 Central carbon metabolism in cancer
    127556083
   05231 Choline metabolism in cancer
    127556083
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    127556083
  09162 Cancer: specific types
   05210 Colorectal cancer
    127556083
   05212 Pancreatic cancer
    127556083
   05225 Hepatocellular carcinoma
    127556083
   05226 Gastric cancer
    127556083
   05214 Glioma
    127556083
   05216 Thyroid cancer
    127556083
   05221 Acute myeloid leukemia
    127556083
   05220 Chronic myeloid leukemia
    127556083
   05218 Melanoma
    127556083
   05211 Renal cell carcinoma
    127556083
   05219 Bladder cancer
    127556083
   05215 Prostate cancer
    127556083
   05213 Endometrial cancer
    127556083
   05224 Breast cancer
    127556083
   05223 Non-small cell lung cancer
    127556083
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127556083
   05170 Human immunodeficiency virus 1 infection
    127556083
   05161 Hepatitis B
    127556083
   05160 Hepatitis C
    127556083
   05171 Coronavirus disease - COVID-19
    127556083
   05164 Influenza A
    127556083
   05163 Human cytomegalovirus infection
    127556083
   05167 Kaposi sarcoma-associated herpesvirus infection
    127556083
   05165 Human papillomavirus infection
    127556083
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    127556083
   05135 Yersinia infection
    127556083
   05133 Pertussis
    127556083
   05152 Tuberculosis
    127556083
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    127556083
   05140 Leishmaniasis
    127556083
   05142 Chagas disease
    127556083
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127556083
   05020 Prion disease
    127556083
   05022 Pathways of neurodegeneration - multiple diseases
    127556083
  09165 Substance dependence
   05034 Alcoholism
    127556083
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127556083
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    127556083
   04933 AGE-RAGE signaling pathway in diabetic complications
    127556083
   04934 Cushing syndrome
    127556083
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    127556083
   01524 Platinum drug resistance
    127556083
   01522 Endocrine resistance
    127556083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:afz01001]
    127556083
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:afz03036]
    127556083
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afz04147]
    127556083
Enzymes [BR:afz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     127556083
Protein kinases [BR:afz01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   127556083
Chromosome and associated proteins [BR:afz03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     127556083
Exosome [BR:afz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   127556083
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 127556083
NCBI-ProteinID: XP_051844926
LinkDB
Position
1:117325083..117332448
AA seq 380 aa
MAAAVAAEGGGGGEPRGVDGSGPGVPGKVEMVKGQPFDVGPRYTELQYIGEGAYGMVSSA
FDHVRKARVAIKKISPFEHQTYCQRTLREIQILLRCHHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPSKPKVPWVKLFPKA
DSKALDLLDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPGAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggtggcggctgaggggggagggggcggggagccccgaggagttgacggg
tccggcccgggggtcccgggaaaggtggagatggtgaagggccagccgtttgacgtggga
ccgcgctacacagagctgcagtacattggggagggggcgtacggcatggtcagctctgct
tttgaccatgttcgaaaggctcgagtagccatcaaaaagatcagcccatttgagcaccag
acatattgccagcgcacccttcgggagattcagatcctgcttcgttgccaccatgagaat
gtcattggcatccgtgacatccttcgagcacccacgctggaagccatgagggatgtttac
attgttcaggacctgatggaaacagacttgtataagctgctcaagagccagcagctgagt
aatgatcatgtctgctacttcctgtaccaaatcctacgaggcctcaaatatatccactca
gccaatgtgcttcatcgggacctcaaaccctccaatctgctcatcaacaccacttgtgac
ctcaagatctgtgactttggcctggcccgaattgctgaccctgagcatgatcatacaggt
ttcctgactgagtatgtggctacccgctggtatagagcaccagagatcatgctcaattct
aagggctataccaaatctatcgatatctggtctgtgggctgtatcctcgcagaaatgctc
tccaatcggcccatcttccctgggaagcactacttggatcagctgaaccacattctaggt
attctaggttctccatcccaggatgatctgaattgtatcatcaacatgaaggctcggaac
tacctacagtcacttccatccaaacctaaggtgccctgggtcaagctgtttcccaaagca
gactccaaagccctggacctgctggaccggatgttgacctttaaccctaacaagcgaatc
acagtggaggatgccctggcccacccctacttggagcagtactatgatccaactgatgag
ccagtggcagaagaaccctttacctttgacatggagttagatgacctgccaaaggaacga
ctgaaggaactcatcttccaagagacagcccgattccaacctggagctccaggagccccc
tga

DBGET integrated database retrieval system