KEGG   Antechinus flavipes (yellow-footed antechinus): 127559280
Entry
127559280         CDS       T08818                                 
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
afz  Antechinus flavipes (yellow-footed antechinus)
Pathway
afz01521  EGFR tyrosine kinase inhibitor resistance
afz01522  Endocrine resistance
afz04010  MAPK signaling pathway
afz04012  ErbB signaling pathway
afz04014  Ras signaling pathway
afz04015  Rap1 signaling pathway
afz04062  Chemokine signaling pathway
afz04068  FoxO signaling pathway
afz04071  Sphingolipid signaling pathway
afz04072  Phospholipase D signaling pathway
afz04137  Mitophagy - animal
afz04140  Autophagy - animal
afz04150  mTOR signaling pathway
afz04151  PI3K-Akt signaling pathway
afz04210  Apoptosis
afz04211  Longevity regulating pathway
afz04213  Longevity regulating pathway - multiple species
afz04218  Cellular senescence
afz04360  Axon guidance
afz04370  VEGF signaling pathway
afz04371  Apelin signaling pathway
afz04540  Gap junction
afz04550  Signaling pathways regulating pluripotency of stem cells
afz04625  C-type lectin receptor signaling pathway
afz04650  Natural killer cell mediated cytotoxicity
afz04660  T cell receptor signaling pathway
afz04662  B cell receptor signaling pathway
afz04664  Fc epsilon RI signaling pathway
afz04714  Thermogenesis
afz04720  Long-term potentiation
afz04722  Neurotrophin signaling pathway
afz04725  Cholinergic synapse
afz04726  Serotonergic synapse
afz04730  Long-term depression
afz04810  Regulation of actin cytoskeleton
afz04910  Insulin signaling pathway
afz04912  GnRH signaling pathway
afz04915  Estrogen signaling pathway
afz04916  Melanogenesis
afz04917  Prolactin signaling pathway
afz04919  Thyroid hormone signaling pathway
afz04921  Oxytocin signaling pathway
afz04926  Relaxin signaling pathway
afz04929  GnRH secretion
afz04933  AGE-RAGE signaling pathway in diabetic complications
afz04935  Growth hormone synthesis, secretion and action
afz05010  Alzheimer disease
afz05022  Pathways of neurodegeneration - multiple diseases
afz05034  Alcoholism
afz05160  Hepatitis C
afz05161  Hepatitis B
afz05163  Human cytomegalovirus infection
afz05165  Human papillomavirus infection
afz05166  Human T-cell leukemia virus 1 infection
afz05167  Kaposi sarcoma-associated herpesvirus infection
afz05170  Human immunodeficiency virus 1 infection
afz05200  Pathways in cancer
afz05203  Viral carcinogenesis
afz05205  Proteoglycans in cancer
afz05206  MicroRNAs in cancer
afz05207  Chemical carcinogenesis - receptor activation
afz05208  Chemical carcinogenesis - reactive oxygen species
afz05210  Colorectal cancer
afz05211  Renal cell carcinoma
afz05213  Endometrial cancer
afz05214  Glioma
afz05215  Prostate cancer
afz05216  Thyroid cancer
afz05218  Melanoma
afz05219  Bladder cancer
afz05220  Chronic myeloid leukemia
afz05221  Acute myeloid leukemia
afz05223  Non-small cell lung cancer
afz05224  Breast cancer
afz05225  Hepatocellular carcinoma
afz05226  Gastric cancer
afz05230  Central carbon metabolism in cancer
afz05231  Choline metabolism in cancer
afz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
afz05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:afz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127559280
   04012 ErbB signaling pathway
    127559280
   04014 Ras signaling pathway
    127559280
   04015 Rap1 signaling pathway
    127559280
   04370 VEGF signaling pathway
    127559280
   04371 Apelin signaling pathway
    127559280
   04068 FoxO signaling pathway
    127559280
   04072 Phospholipase D signaling pathway
    127559280
   04071 Sphingolipid signaling pathway
    127559280
   04151 PI3K-Akt signaling pathway
    127559280
   04150 mTOR signaling pathway
    127559280
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    127559280
   04137 Mitophagy - animal
    127559280
  09143 Cell growth and death
   04210 Apoptosis
    127559280
   04218 Cellular senescence
    127559280
  09144 Cellular community - eukaryotes
   04540 Gap junction
    127559280
   04550 Signaling pathways regulating pluripotency of stem cells
    127559280
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    127559280
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    127559280
   04650 Natural killer cell mediated cytotoxicity
    127559280
   04660 T cell receptor signaling pathway
    127559280
   04662 B cell receptor signaling pathway
    127559280
   04664 Fc epsilon RI signaling pathway
    127559280
   04062 Chemokine signaling pathway
    127559280
  09152 Endocrine system
   04910 Insulin signaling pathway
    127559280
   04929 GnRH secretion
    127559280
   04912 GnRH signaling pathway
    127559280
   04915 Estrogen signaling pathway
    127559280
   04917 Prolactin signaling pathway
    127559280
   04921 Oxytocin signaling pathway
    127559280
   04926 Relaxin signaling pathway
    127559280
   04935 Growth hormone synthesis, secretion and action
    127559280
   04919 Thyroid hormone signaling pathway
    127559280
   04916 Melanogenesis
    127559280
  09156 Nervous system
   04725 Cholinergic synapse
    127559280
   04726 Serotonergic synapse
    127559280
   04720 Long-term potentiation
    127559280
   04730 Long-term depression
    127559280
   04722 Neurotrophin signaling pathway
    127559280
  09158 Development and regeneration
   04360 Axon guidance
    127559280
  09149 Aging
   04211 Longevity regulating pathway
    127559280
   04213 Longevity regulating pathway - multiple species
    127559280
  09159 Environmental adaptation
   04714 Thermogenesis
    127559280
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    127559280
   05206 MicroRNAs in cancer
    127559280
   05205 Proteoglycans in cancer
    127559280
   05207 Chemical carcinogenesis - receptor activation
    127559280
   05208 Chemical carcinogenesis - reactive oxygen species
    127559280
   05203 Viral carcinogenesis
    127559280
   05230 Central carbon metabolism in cancer
    127559280
   05231 Choline metabolism in cancer
    127559280
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    127559280
  09162 Cancer: specific types
   05210 Colorectal cancer
    127559280
   05225 Hepatocellular carcinoma
    127559280
   05226 Gastric cancer
    127559280
   05214 Glioma
    127559280
   05216 Thyroid cancer
    127559280
   05221 Acute myeloid leukemia
    127559280
   05220 Chronic myeloid leukemia
    127559280
   05218 Melanoma
    127559280
   05211 Renal cell carcinoma
    127559280
   05219 Bladder cancer
    127559280
   05215 Prostate cancer
    127559280
   05213 Endometrial cancer
    127559280
   05224 Breast cancer
    127559280
   05223 Non-small cell lung cancer
    127559280
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127559280
   05170 Human immunodeficiency virus 1 infection
    127559280
   05161 Hepatitis B
    127559280
   05160 Hepatitis C
    127559280
   05163 Human cytomegalovirus infection
    127559280
   05167 Kaposi sarcoma-associated herpesvirus infection
    127559280
   05165 Human papillomavirus infection
    127559280
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127559280
   05022 Pathways of neurodegeneration - multiple diseases
    127559280
  09165 Substance dependence
   05034 Alcoholism
    127559280
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127559280
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    127559280
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    127559280
   01522 Endocrine resistance
    127559280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afz04131]
    127559280
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afz04147]
    127559280
   04031 GTP-binding proteins [BR:afz04031]
    127559280
Membrane trafficking [BR:afz04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    127559280
 Endocytosis
  Macropinocytosis
   Ras GTPases
    127559280
Exosome [BR:afz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   127559280
  Exosomal proteins of other body fluids (saliva and urine)
   127559280
  Exosomal proteins of breast cancer cells
   127559280
  Exosomal proteins of colorectal cancer cells
   127559280
GTP-binding proteins [BR:afz04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    127559280
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 127559280
NCBI-ProteinID: XP_051848912
LinkDB
Position
4:48719439..48727727
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CLGLSCSVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagctggcggtgtggggaaaagcgccttgacc
atccagctcatccagaaccacttcgtagacgaatatgatcccacgatagaggactcctat
cgaaagcaagtggttattgatggtgagacctgtttgttggacatacttgacacagctgga
caagaagagtatagtgccatgagagaccagtatatgaggacaggcgaaggctttctctgt
gtctttgccatcaacaatagcaaatcatttgcagacattaacctctacagggaacaaatt
aaacgagtgaaagactcagatgatgtgcctatggtgctggtgggaaataagtgtgatctg
ccaacacggacagttgacacaaaacaggctcatgaactagccaagagctatggaattcct
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaataagacagtaccgcatgaaaaaactcaacagtagcgatgatggaactcaaggc
tgcctgggtctttcatgttcagtcatgtaa

DBGET integrated database retrieval system