| Entry |
|
|---|
| Symbol |
nahAb
|
|---|
| Name |
(KEGG) naphthalene 1,2-dioxygenase ferredoxin component
|
|---|
| KO |
| K14578 | naphthalene 1,2-dioxygenase ferredoxin component |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas |
|---|
| Organism |
Pseudomonas putida
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| AA seq |
104 aa
MTVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGR
EIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS |
|---|
| Reference |
|
|---|
| Authors |
Dennis JJ, Zylstra GJ |
|---|
| Title |
Complete sequence and genetic organization of pDTG1, the 83 kilobase naphthalene degradation plasmid from Pseudomonas putida strain NCIB 9816-4. |
|---|
| Journal |
|
|---|
