KEGG   Addendum: AAC44479
Entry
AAC44479          CDS       T10000                                 
Symbol
dntB
Name
(KEGG) 4-methyl-5-nitrocatechol 5-monooxygenase (EC:1.14.13.210)
  KO
K21683  4-methyl-5-nitrocatechol 5-monooxygenase [EC:1.14.13.210]
Taxonomy
TAX:69003
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia
Organism
ag  Addendum (Burkholderia sp. RASC)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox Pyr_redox_2 FAD_binding_2 NAD_binding_8
Other DBs
NCBI-ProteinID: AAC44479
GB: U68411
UniProt: Q2PWU9
LinkDB
AA seq 548 aa
MTRPLETPPDIEVPVLIVGGSMVGLSTALFLSHYGIQAMAVERHERTAIHPRAGHFHLRT
LELLRSVGLEEVVARTSAEAFFPNGGINAVQSLAGGETASFISNLNAGVEEFSPTRRLFI
AQQALEPILRSRAEELGADLRYSTEVVSVVDDGEGVTTVIRDKASGQERTVRSRYLVASD
GWRSQRRAQLGIETRGQGLLSRSATIYFRADCRELLAGTHLGVIYVLNERLRGFFRFEKS
LQSGFLGVATLGDPTRPGALDVSAGFTTDTAVELVRAAIGVPDIDVEIQDVAHWEATAAL
ADRYRGGRIFLRGDAAHVVPPYGGFGGNTGVQDAHNLASKLALVLDGTAGEALLDTYEAE
RRPVGALTVDQAFSRYIRRLAPEFLDEQTPELVDDFSMELGYRYHSPAVLTEDDDKAVDQ
AVVGHPREALGRPGSRAPHVALRVDDHDRSVLDLLGRDFVVLAGPAGQVWAEAAERASKE
LGLPLSAYVVGSDTPVADVEGRFADAYGLSDAGVALVRPDGFIAWRSRDLAEDPEAALTD
ALRAVLCR
Reference
PMID:8830701
  Authors
Haigler BE, Suen WC, Spain JC
  Title
Purification and sequence analysis of 4-methyl-5-nitrocatechol oxygenase from Burkholderia sp. strain DNT.
  Journal
J Bacteriol 178:6019-24 (1996)
DOI:10.1128/JB.178.20.6019-6024.1996

DBGET integrated database retrieval system