KEGG   Addendum: AAD13626
Entry
AAD13626          CDS       T10000                                 
Symbol
tcbD
Name
(KEGG) chloromuconate cycloisomerase (EC:5.5.1.7)
  KO
K01860  chloromuconate cycloisomerase [EC:5.5.1.7]
Taxonomy
TAX:306
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp.)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Other DBs
NCBI-ProteinID: AAD13626
GB: M57629
UniProt: P27099
Structure
LinkDB
AA seq 370 aa
MKIEAISTTIVDVPTRRPLQMSFTTVHKQSYVIVQVKAGGLVGIGEGGSVGGPTWGSESA
ETIKVIIDNYLAPLLVGKDASNLSQARVLMDRAVTGNLSAKAAIDIALHDLKARALNLSI
ADLIGGTMRTSIPIAWTLASGDTARDIDSALEMIETRRHNRFKVKLGARTPAQDLEHIRS
IVKAVGDRASVRVDVNQGWDEQTASIWIPRLEEAGVELVEQPVPRANFGALRRLTEQNGV
AILADESLSSLSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYGGTMLD
STVGTAAALHVYATLPSLPYGCELIGPWVLGDRLTQQDLEIKDFEVHLPLGSGLGVDLDH
DKVRHYTRAA
Reference
PMID:2013566
  Authors
van der Meer JR, Eggen RI, Zehnder AJ, de Vos WM
  Title
Sequence analysis of the Pseudomonas sp. strain P51 tcb gene cluster, which encodes metabolism of chlorinated catechols: evidence for specialization of catechol 1,2-dioxygenases for chlorinated substrates.
  Journal
J Bacteriol 173:2425-34 (1991)
DOI:10.1128/JB.173.8.2425-2434.1991
Reference
PMID:8550433
  Authors
Muller D, Schlomann M, Reineke W
  Title
Maleylacetate reductases in chloroaromatic-degrading bacteria using the modified ortho pathway: comparison of catalytic properties.
  Journal
J Bacteriol 178:298-300 (1996)
DOI:10.1128/JB.178.1.298-300.1996
Reference
  Authors
Kajander T, Lehtio L, Schlomann M, Goldman A
  Title
The structure of Pseudomonas P51 Cl-muconate lactonizing enzyme: co-evolution of structure and dynamics with the dehalogenation function.
  Journal
Protein Sci 12:1855-64 (2003)
DOI:10.1110/ps.0388503

DBGET integrated database retrieval system