KEGG   Addendum: AAF34254
Entry
AAF34254          CDS       T10000                                 
Symbol
TAT
Name
(KEGG) taxadien-5-alpha-ol O-acetyltransferase (EC:2.3.1.162)
  KO
K12923  taxadien-5alpha-ol O-acetyltransferase [EC:2.3.1.162]
Taxonomy
TAX:99806
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers II; Cupressales; Taxaceae; Taxus
Organism
ag  Addendum (Taxus cuspidata)
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-ProteinID: AAF34254
GB: AF190130
UniProt: Q9M6F0
LinkDB
AA seq 439 aa
MEKTDLHVNLIEKVMVGPSPPLPKTTLQLSSIDNLPGVRGSIFNALLIYNASPSPTMISA
DPAKPIREALAKILVYYPPFAGRLRETENGDLEVECTGEGAMFLEAMADNELSVLGDFDD
SNPSFQQLLFSLPLDTNFKDLSLLVVQVTRFTCGGFVVGVSFHHGVCDGRGAAQFLKGLA
EMARGEVKLSLEPIWNRELVKLDDPKYLQFFHFEFLRAPSIVEKIVQTYFIIDFETINYI
KQSVMEECKEFCSSFEVASAMTWIARTRAFQIPESEYVKILFGMDMRNSFNPPLPSGYYG
NSIGTACAVDNVQDLLSGSLLRAIMIIKKSKVSLNDNFKSRAVVKPSELDVNMNHENVVA
FADWSRLGFDEVDFGWGNAVSVSPVQQQSALAMQNYFLFLKPSKNKPDGIKILMFLPLSK
MKSFKIEMEAMMKKYVAKV
Reference
  Authors
Walker K, Schoendorf A, Croteau R
  Title
Molecular cloning of a taxa-4(20),11(12)-dien-5alpha-ol-O-acetyl transferase cDNA from Taxus and functional expression in Escherichia coli.
  Journal
Arch Biochem Biophys 374:371-80 (2000)
DOI:10.1006/abbi.1999.1609

DBGET integrated database retrieval system